KEGG   Saccharomyces cerevisiae (budding yeast): YKR016WHelp
Entry
YKR016W           CDS       T00005                                 

Gene name
MIC60, AIM28, FCJ1, FMP13
Definition
(RefSeq) Mic60p
  KO
K17785  mitofilin
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YKR016W (MIC60)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    YKR016W (MIC60)
   MINOS/MitOS complex (yeast)
    YKR016W (MIC60)
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    YKR016W (MIC60)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mitofilin Focal_AT DUF4954 Peroxin-13_N DUF4407 Wax2_C
Motif
Other DBs
NCBI-GeneID: 853886
NCBI-ProteinID: NP_012941
SGD: S000001724
UniProt: P36112
Position
XI:469717..471339
Genome map
AA seq 540 aa AA seqDB search
MMLRTTASRKIVLRRGLASINTGTTVASKKASHKFRNTLWTIALSATAFYAGGIIYSQKN
DKFGDFFSNNVPFAEDLLETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSN
RENIEVKKILSLEPLNIETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQ
NMLTNLSQLNETLKEALSNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKE
NLTKQKDKELEEKLKANEELLQAKHANEVGLLSITQVKEFNKIIKDKIEKERNGRLAHLE
EINSEVNDLSKSIDRSSKILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLL
SNLLSTFNKKSCCDDGDCCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCS
GKKILSNEQIYNRWNLLADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFD
SVYARVGDNLRVSNLNDAVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgatgctaagaactactgcctcacgaaaaattgtgctaaggaggggtctagccagcata
aacacagggactaccgttgcatcaaaaaaggcttcgcacaaatttcgcaataccctttgg
actattgctttgtcagcgacagctttctacgctggaggtatcatatattcgcaaaaaaat
gacaaatttggtgactttttctctaataacgttccttttgccgaggatttactagaaaca
tatgaacactatcacgataggccaacattgtttttagaagattcttgggacggcttgaag
gcaaagagcaatgatttattatctggattaactggtagttcacaaacgcgcagatctaat
agggaaaatattgaagtaaaaaaaatcttatcattagaaccactaaatattgaaacagaa
aattctgatccgcaactgaaagaaatcattggctctttgaatgatctcatcaacagtcta
aatgactcaaacctctccatccccgaatcagaattcaattcaatcaaaaaatctaaccag
aatatgcttacgaatctatcccaattaaatgaaacgttaaaagaggctttatccaattac
atgatacaaagaacatcagaagtaatcacggaattgaacacacaatatgaaaactcgaaa
agggagtttgaaaagaatcttcaaaaaaacctattacaagaagtagacgaattcaaagaa
aacttgaccaagcaaaaggacaaagaactagaagaaaaattaaaggcgaacgaagaattg
ttacaagccaaacatgcaaatgaagtgggcttactatccatcactcaagtcaaagaattt
aataaaattatcaaagacaaaattgagaaggaaagaaatggcagattagcccatttagag
gaaataaattctgaagttaacgacctcagcaaatccatcgacagatcgagcaaaatctta
agtaaaaacgaggctctagtgcaattaactttccaagtagatgagatcaaatctaggatt
aacaacaataacttacccgatgtgaatatcgacaaggaactatccagattgaaacttctt
tccaatcttctctctaccttcaacaaaaaatcttgttgcgacgatggcgactgctgctcc
tgcaaaaagggtaataagaatgaaggcaaggaagggaagatatcatgcaaatgcaaacca
aagacaaaccctccatcgctattaagcgtagctttagatgaattagaatccacatgtagc
ggtaaaaaaatcttatcgaatgagcagatctataacaggtggaacttactggcagatgac
tttaagacagcctctttattgccaccaaattccggtattttggggcaattaaccgccaaa
gttttttcccttttcttattcacaaagacaggtaatccttcaaatgccacggatttcgat
tctgtttatgcaagagtcggcgataacttgagggtatccaacctcaacgatgctgtagaa
gaggttgtctccctaaagggttggcctcataaagtttgcgaaagctggatcgaagatgct
agaagaaaattagaagtccagcgcctggtagagattcttgactgtgaaataaggacgttg
tga

DBGET integrated database retrieval system