KEGG   Saccharomyces cerevisiae (budding yeast): YKR018CHelp
Entry
YKR018C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3808 HrpB1_HrpK
Motif
Other DBs
NCBI-GeneID: 853888
NCBI-ProteinID: NP_012943
SGD: S000001726
UniProt: P36114
Position
XI:complement(473723..475900)
Genome map
AA seq 725 aa AA seqDB search
MFKVFGFGAKEEIPELSQEEKTKAILKQAHDFEQALRAMDYVLDDNADEGLALLDESDAK
EASDQTINALARGVIEFLEATLGFEAEEMKKASATLAKAEALSLKSRERAQKIGLKSSSL
YPPGTVYAVTYTESCLLHALLMIFSESMMEAAKAILKLRKSYYMLQEILETIKAANKAKK
LKITSGSEDKESTPATFITGGDAFNSVDIPYELTPEEQKDKDLLQFAEQIHSMRTERLSG
AHIGNSPAINRLRGELGLQAMEDLPEEEITDHKVLSDDIDLSQATIDEFVHSGVNLCFGI
LQVVISLLPPAIGAVLSVVGFRGSREEGLRLVWKATKQRNVHGCIGLLALMFYYDGPFQF
TDDDFDIPAAVKDSSNSEDSEDEEMDGPTLLHPGKILEDALLQSRALFPNSALWLLNEAR
MLSGKGRLEEAVALMDSIDVSKIRMRQVKSLMIFDRAITLIHLHQYDRAAEDILSLLDIS
DWSHAFYTYFAGCCYLENWRMCEMGLMKSDKKDEYQKKAEELIFTSVNLLGKKTFKSKNL
PLDRFILRKVEQFKAKKEELGVENPLDGIATSPVHEIAYFYNGYNRMSEEHLELTKKMLT
EYRNPAIEALDSDQELIKDLLVSLTLRRLGHIQEGCDILDEKVLPKFFSIQNGKVKYIKK
TEDPWAYPTALYERALFTWKLEGMDGLPESKEWLLRAQGYADDYELSTRVGMKIKAAIDR
VDHSL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagtgtttggttttggtgcgaaggaagagattcctgagctttcacaggaagaa
aaaactaaagccattctaaaacaagctcatgatttcgaacaggcactgcgtgcgatggac
tatgtcttagatgataatgctgacgagggtttggctttgctggatgagagtgatgctaaa
gaagcttccgaccaaactataaatgcgttagctcgtggtgtcattgaatttttggaggcc
actttaggttttgaagctgaagagatgaaaaaagcttctgcgactttggccaaggcagaa
gctttatctttgaaaagtagagagagggctcaaaaaattggattgaagagcagttcttta
tatcctccaggaacagtttatgccgtgacttatacagaatcatgccttctacatgcccta
ttgatgattttcagtgaaagtatgatggaggcggccaaggccattttaaagctcagaaag
tcgtactatatgttacaagaaatcttggaaactattaaagctgctaacaaagccaagaaa
ttgaaaattacgtcaggcagtgaagataaggagtccaccccagcgactttcataactggt
ggcgatgcgttcaattccgttgatataccttatgaactgactcctgaagaacaaaaggat
aaggatcttttacaatttgctgaacaaattcatagcatgaggactgaaagattatctggc
gcccacattggcaactctcctgcaattaacaggttgagaggtgagctaggactacaagca
atggaagacttgccagaagaggaaataacagatcataaagttctttcggatgatatagat
ttaagtcaagcaacaattgatgagtttgtccattctggtgtcaatttatgctttggtatt
ttacaggttgtgatatcactattaccacccgctattggcgcggtcctatctgtggttgga
ttcaggggttccagagaagaaggtttgagacttgtttggaaagccacaaagcaaagaaac
gtgcatggttgtattggtttgttagccctgatgttttactatgatggacctttccaattc
actgacgatgattttgatattcctgcagcagttaaggattccagtaacagtgaagattct
gaagatgaagagatggatggccctacgttgttgcatcctgggaaaatactggaagatgcg
ttgctgcaatcaagagcgctatttcccaatagtgcgctatggttattgaatgaggcaagg
atgctatctggtaaagggcgtttagaggaagcagtcgcattgatggattcgattgatgtt
agcaagatacggatgagacaggtcaaatccttgatgatttttgaccgtgctataacattg
atccatttgcatcaatacgatagagctgcagaagatattttatcgctattagacatcagt
gattggtcacacgctttttacacatattttgctggctgctgttatttagaaaattggaga
atgtgcgaaatgggattaatgaagtcagacaaaaaggatgaataccaaaagaaggccgaa
gaacttatcttcacctctgtgaatttgctaggtaagaaaaccttcaaatcgaagaacctg
ccattagataggtttattctgagaaaagttgagcaatttaaagcgaaaaaggaggaactt
ggggtggaaaatcctctggatggtatcgctacttcaccagtacacgaaattgcgtacttc
tacaatggttataatagaatgtctgaagagcatttggagctaacaaagaaaatgctaact
gagtatagaaatcccgccattgaagctttagactcagatcaggagttaatcaaagatctc
ttggtctctttgacattaagaagattaggtcatatccaagaaggttgtgatatattggat
gaaaaggttctacctaagtttttctccattcaaaatggcaaggtcaaatatataaagaaa
actgaagatccatgggcctatccgactgcactttatgaacgtgctctatttacatggaag
ttggagggcatggatggccttccagagagtaaagaatggttactgagggctcagggctac
gcagatgattatgaattgagtacgagagtaggtatgaaaattaaggctgccattgaccgc
gttgaccattcattgtaa

DBGET integrated database retrieval system