KEGG   Saccharomyces cerevisiae (budding yeast): YKR027W
Entry
YKR027W           CDS       T00005                                 

Gene name
BCH2, FMP50
Definition
(RefSeq) Bch2p
  KO
K19880  Chs5-Arf1p-binding protein CHS6/BCH2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKR027W (BCH2)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Others
   Exomer complex
    YKR027W (BCH2)
SSDB
Motif
Pfam: ChAPs
Other DBs
NCBI-GeneID: 853898
NCBI-ProteinID: NP_012952
SGD: S000001735
UniProt: P36122
Position
XI:491364..493661
AA seq 765 aa
MSFLWGSTKSKKGKNKKAAGSLPSGVVPQQRVKPTRKNVPIDYPRTLEKVHGESLIFRTS
LLSELVSTGKSGIGPPDLIHCTELDKFHDEKIGEFFYITGIDASSVSMPIAFLKLIKWND
GKKLKSASLKNDDITTYCTFNIFQKLDIRLRYESEDVYQVNIVDCLNGNNEIPLSDLIWE
ETFVSCCIRSVIINSDFERKIPGLVELPFVFENRCASDYKRVIDSLCKFLPRFLECGWDS
TKSVYATILNNYLTESLLVFLSITPEFITDYAIQVLDNLMTNDPSNSRYYAIVIISIMER
SNDRDVEMIKRIHEILDLLLPVLYGLPSDEPYISDLINCITDVLSIQARFLLNNNDYELS
LSISTLATNLSSDNFESWYLLSKGYIFSQQYDKALLSINSMPCLAEYDIVKQAQINAFKF
YMNYYKAPLCHSREHCTMTSHELNHLMNIMHYENELELKTIIFGRTVMPNESKYGCIEEI
WNKSCLELGPICGPQSDNLINFVSQQEVNTVGDMLLLKRSKETRQESWFIKQVRLLLMEL
VARIGWNALLQLRSDVFVMESKFKMIESSDKLSTELRQKRLCQRWFDAMFLDVYEDLSIS
TSSQENKATAKYSGLEWELLGLTLLRVSDLPDAVACLRTSILARFDPISCHHLLNFYLTM
DFNDEFMRRFDVDIILDLLVKLISFRIRFYDRFQIFSLQVLRKLEGQLGSEIIKNKIINS
PYGQAGITSVIDYMLECLSKNRNEACLAYERPLPDLPSTIKPLAD
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgagttttttatgggggtctacaaagtccaagaaaggcaagaataaaaaggctgcaggt
tctcttccgtcaggtgttgttccacagcaacgtgtgaaaccaacacgtaaaaacgttcct
atagattatccaagaactttggaaaaagtacatggtgaaagtttaatctttaggacgtcc
cttttaagtgaattggtgagcactggtaaatctggtattggtcctccagacttgattcat
tgtacagagttagataaatttcacgatgagaaaataggtgaattcttttacatcacgggg
atcgacgcctcgagcgtctctatgccaattgcatttttgaagctgataaaatggaatgat
ggtaagaaactaaaatcagcatctttgaagaacgacgacatcacaacctactgcactttc
aatatctttcaaaaattggacattagattaagatatgaatctgaagatgtttatcaagtt
aatatcgttgactgtttaaatggcaacaatgaaataccgttgagtgatcttatttgggaa
gaaactttcgttagctgttgcataagaagcgtaattattaattcagattttgaaagaaaa
atacctgggctagtggaattaccatttgtttttgagaacagatgcgcgagtgattataaa
agggtgatagattcgttatgcaaatttttgccaagatttttagaatgtggttgggattct
acaaagagcgtctatgcaacgatactgaataactacctaactgaatcattattagtattt
ctgtctataactccagaattcataacagactatgcgatccaggttttagacaacttgatg
acgaatgacccgtcaaattctagatattacgctattgtaattatttctatcatggagcga
agtaatgaccgcgatgtagaaatgatcaaacggatacacgagatattagacctattacta
cccgtactgtatggattgccatccgatgaaccttacatttctgatttgatcaattgcatc
accgatgtattaagcatccaagcaaggtttctattgaacaataacgactatgaactttct
ttatccatttccacattggccacgaatttatcttctgataattttgaatcttggtatctg
ttatctaaaggctatattttttcacaacagtatgataaggcactgctctcaatcaattcg
atgccctgtttagcggaatatgatatcgttaaacaagcccagattaacgcttttaagttt
tatatgaactactacaaggcaccactatgtcatagcagagaacactgtaccatgacatca
cacgagttaaatcacctcatgaatattatgcattatgaaaatgagttggagttgaagaca
ataatatttggacgcactgtaatgcccaatgaatctaagtatggatgtattgaagagata
tggaataaatcctgtcttgaattaggacctatttgtggaccacagagtgacaatctcata
aactttgtatctcagcaggaggtaaatacagtaggagatatgctgttactaaaacgaagc
aaagaaaccagacaagagagttggtttataaagcaagtacgtcttctgttgatggaatta
gtcgctagaatcggctggaacgccttacttcagctaagatctgacgttttcgttatggag
agtaaattcaaaatgatagaatcttcggacaagctgtccacagaattacgccagaagagg
ctctgtcagagatggtttgatgctatgtttctggacgtttacgaagatttaagtattagc
acttcatctcaagaaaataaggctacggcgaaatacagcgggttggaatgggaactactt
ggcttaactctgcttcgagtgagtgacttacccgatgcagtagcgtgtctacgaactagt
attttggcaaggtttgaccctattagttgtcaccatctgttgaacttttatttaaccatg
gattttaatgatgagtttatgagaaggtttgacgtcgatatcattttagatctattagtg
aaattgatctcctttcggatacgattctatgatagatttcagatattttcccttcaagta
ctaaggaaactagagggacagctgggctccgaaattattaagaataaaataattaattct
ccttacgggcaagctggcatcacttcggtgatagattatatgcttgaatgcctctctaaa
aataggaatgaagcctgcctagcctatgaacgccctcttccagatcttccttccactatc
aaacctctggcagactaa

DBGET integrated database retrieval system