KEGG   Saccharomyces cerevisiae (budding yeast): YKR086WHelp
Entry
YKR086W           CDS       T00005                                 

Gene name
PRP16, PRP23, RNA16
Definition
(RefSeq) DEAH-box RNA helicase PRP16
  KO
K12815  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX38/PRP16 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YKR086W (PRP16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YKR086W (PRP16)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YKR086W (PRP16)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   Step II factors
    YKR086W (PRP16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 AAA_19 PhoH DUF2075 ATPase ABC_tran AAA_14 SRP54 T2SSE AAA_24 Herpes_ori_bp AAA_7 AAA_33 TrwB_AAD_bind Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 853961
NCBI-ProteinID: NP_013012
SGD: S000001794
UniProt: P15938
Structure
PDB: 

Position
XI:599857..603072
Genome map
AA seq 1071 aa AA seqDB search
MGHSGREERIKDIFKELTSKELTPGLLLTLQKLAQKPNTNLEQFIASCKALTKLSSNNPI
IFNELLELLKNKSEEDSTGPKKIAPSINKRKKFKIQLDLDDNEDELDSPVQKKPAPTRTL
FKRIDKLKAKQLRQYSPTVKDPSPNSEQQTQNGHAETKDYEPTRSEVVEEDREWYDNDDD
YGNLVPEPLSELPEEAKLLPVIRNIDNDDALRNTVQLYPIPLKQRMEWIPPFLSKFALEN
KVPTSIIIGSISETSSQVSALSMVNPFRNPDSEFSANAKRGSKLVALRRINMEHIQQSRD
NTTVLNTAMGEVLGLENNNKAKDKSNQKICDDTALFTPSKDDIKHTKEQLPVFRCRSQLL
SLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVAAISVAKRVAME
MQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSL
NTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFGNAPQFTIPGRTFPVQTIYTSNP
VQDYVEAAVSQAVKIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFLQVYSKKFGTANF
EEINDIEILPIYSALPADLQFKIFQDLHGTKRKIIIATNIAETSLTIKGIRYVIDCGYSK
LKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQ
RTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSGQLTPLGLQM
AKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQVFYRPKERQKEADIARNKFFIAKS
DHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPVISSGKDW
DIIKKCICSGFAHQAAKITGLRNYVHLKTGVSVQLHPTSALHGLGDLPPYVVYHELLMTS
KEYICCVTSVDPFWLMEYGGLLYDIKRIKNDQEATTTGLFGEHYEHTLDKVEDDIDINIR
RCKDMRDSVIQELKMTDNSNKEDKKQKTKKQNILNGKENSMKPFKRRKPFF
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgggtcattcggggcgtgaggaaaggataaaagacatatttaaggaacttacgtcaaaa
gaactaacgcctgggttgcttttgacactgcagaaactagcgcaaaagccgaatactaat
ctagaacagtttattgccagctgtaaagctttgacgaaactcagcagtaacaatccaatc
atttttaatgaacttctggagctcctcaagaataaatctgaagaggactcgacaggccca
aagaaaatcgccccttctataaataagagaaagaaatttaagatccagttagaccttgac
gataatgaagatgagctagattctccagttcaaaaaaaaccagcacctacacggacgttg
ttcaagagaatagataaactaaaggccaaacagttgaggcagtattcgcccaccgtgaag
gatccttctccaaatagtgaacagcaaacacagaatggtcatgctgaaacgaaggactat
gaaccgactcgaagcgaagtagttgaggaggacagagaatggtatgataatgatgatgat
tatggaaatttggtgcctgaacctctgtctgaattgcctgaggaagcgaaactactacct
gtcattaggaatatcgacaacgatgatgccttacgaaataccgttcaattataccccata
ccactcaagcaaagaatggaatggatccctccttttttatcaaagtttgctcttgaaaac
aaagtgcccacttccataattatcgggtccatctctgagacgtccagccaagtatccgct
ttatcaatggtgaatccatttaggaatcctgacagtgaattttctgcgaacgccaaacga
ggtagtaagctggttgccttgagaaggataaacatggaacatattcaacaatctcgagac
aacaccactgttttgaacactgccatgggggaagtactaggcttggagaataacaataaa
gcaaaagataagagcaaccaaaagatttgcgacgatacagctcttttcacgccatcaaaa
gatgacattaaacatactaaagagcaactgcctgttttccgctgcagatctcaattgtta
tcattgataagagaaaatcaagtagtggtgataattggtgaaacgggctcaggtaaaacc
acgcaacttgcacagtatttatatgaagaaggatatgccaacgatagggggaaatctatt
gttgtcacacagccgagaagagtagcagccatatccgttgcaaaaagggttgcaatggaa
atgcaagttccattgggtaaggaagtaggctattctataaggtttgaagatgtgacggat
tctgagtgtacaaaacttaagtttgtaacggatggtattctactcagagagaccttattg
gatgatacactcgataaatattcgtgtgttattattgatgaagctcatgaaaggtcatta
aatacagacattttactaggttttttcaagattttattagcacgtagaagagatctaaaa
ctcataatcacttcagcaacaatgaatgcgaagaagttctccgcattttttggtaatgct
cctcagttcacaattcctggaagaactttccccgtacagaccatatatacttccaaccct
gttcaagactacgtagaagctgcagtttctcaggctgtgaaaattcatttagcaaacgat
tgttcaagcggtgatattctcattttcatgacaggtcaagaagatattgaaacaacgttc
gacactctgcaagaaaagtttttgcaagtatattctaaaaagtttggtaccgcaaacttt
gaagagatcaatgatattgaaattttaccaatctactcggctttacctgcagatttgcaa
ttcaaaatttttcaggatctacatggcactaaaaggaaaattataattgcgacaaatatt
gcagagacttcattgaccattaaaggtattagatatgtcattgattgtggttactctaaa
ctgaaagtttacaatccaaagattgggcttgatagtttagtaataacgcccatatcaaaa
gctaacgccgaccaaagatccggaagagcgggaagaactgcgccaggcactgcatatcga
ttatacacggaagatacattcaaagaagatatgtacttacagacaatacctgagatccaa
agaacgaatttgtcaaacacccttttactgctaaaatctctggacgttactgacgaattg
agtaagttcccgttcattgataaaccacccttacaaacatttttatcctcattgtatgag
ttatggttcataggggctatagacactagtggacaattgactccattgggattacagatg
gcaaaatttcccctgcaaccttccctttccaaaattttattaattgcagttagaaacggc
tgcagtgatgaaatgttaacaatagtttccatgctttctgttccacaagtcttttataga
cccaaggaaagacagaaagaagcagatattgctagaaataaattttttatcgcgaaatca
gatcacttaacgttacttaatgtttttgaacaatggagggcaaataattttagttcgcat
tggtgtaacaaacattttgttcaatacaaatcacttgtcagggcaagagacattcgagac
cagttgctaacaatactaaaatctcaaaaaattccggtcatttcctccggtaaggactgg
gatattattaaaaaatgtatttgttcaggatttgctcatcaagcagccaaaataacagga
ctacgaaattacgttcatttaaaaactggcgtaagtgttcaactacaccctacaagtgca
ttacacggattgggggatttacccccttacgtggtatatcatgaattattaatgactagc
aaagaatacatttgttgtgttacttctgtagatccattctggttaatggaatatggtggg
ttactctacgacatcaagcgtattaaaaatgatcaggaggccacaactacaggcctcttt
ggtgaacactatgaacatactctggacaaggttgaagatgatattgatatcaatattagg
agatgtaaggatatgagagacagtgtgatacaggagctcaaaatgaccgacaattcaaac
aaagaagacaaaaagcaaaaaacgaaaaagcaaaatatactgaacggcaaagaaaattca
atgaaacctttcaaaagaaggaagccttttttttag

DBGET integrated database retrieval system