KEGG   Saccharomyces cerevisiae (budding yeast): YKR089CHelp
Entry
YKR089C           CDS       T00005                                 

Gene name
TGL4, STC1
Definition
(RefSeq) Tgl4p
  KO
K14674  TAG lipase / steryl ester hydrolase / phospholipase A2 / LPA acyltransferase [EC:3.1.1.3 3.1.1.13 3.1.1.4 2.3.1.51]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00100  Steroid biosynthesis
sce00561  Glycerolipid metabolism
sce00564  Glycerophospholipid metabolism
sce00565  Ether lipid metabolism
sce00590  Arachidonic acid metabolism
sce00592  alpha-Linolenic acid metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    YKR089C (TGL4)
   00561 Glycerolipid metabolism
    YKR089C (TGL4)
   00564 Glycerophospholipid metabolism
    YKR089C (TGL4)
   00565 Ether lipid metabolism
    YKR089C (TGL4)
   00590 Arachidonic acid metabolism
    YKR089C (TGL4)
   00591 Linoleic acid metabolism
    YKR089C (TGL4)
   00592 alpha-Linolenic acid metabolism
    YKR089C (TGL4)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     YKR089C (TGL4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     YKR089C (TGL4)
    3.1.1.4  phospholipase A2
     YKR089C (TGL4)
    3.1.1.13  sterol esterase
     YKR089C (TGL4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3336 Patatin PPIP5K2_N
Motif
Other DBs
NCBI-GeneID: 853964
NCBI-ProteinID: NP_013015
SGD: S000001797
UniProt: P36165
Position
XI:complement(605633..608365)
Genome map
AA seq 910 aa AA seqDB search
MSSKISDLTSTQNKPLLVTQQLIEKYYEQILGTSQNIIPILNPKNKFIRPSKDNSDVERV
EEDAGKRLQTGKNKTTNKVNFNLDTGNEDKLDDDQETVTENENNDIEMVETDEGEDERQG
SSLASKCKSFLYNVFVGNYERDILIDKVCSQKQHAMSFEEWCSAGARLDDLTGKTEWKQK
LESPLYDYKLIKDLTSRMREERLNRNYAQLLYIIRTNWVRNLGNMGNVNLYRHSHVGTKY
LIDEYMMESRLALESLMESDLDDSYLLGILQQTRRNIGRTALVLSGGGTFGLFHIGVLGT
LFELDLLPRVISGSSAGAIVASILSVHHKEEIPVLLNHILDKEFNIFKDDKQKSESENLL
IKISRFFKNGTWFDNKHLVNTMIEFLGDLTFREAYNRTGKILNITVSPASLFEQPRLLNN
LTAPNVLIWSAVCASCSLPGIFPSSPLYEKDPKTGERKPWTGSSSVKFVDGSVDNDLPIS
RLSEMFNVDHIIACQVNIHVFPFLKLSLSCVGGEIEDEFSARLKQNLSSIYNFMANEAIH
ILEIGSEMGIAKNALTKLRSVLSQQYSGDITILPDMCMLFRIKELLSNPTKEFLLREITN
GAKATWPKVSIIQNHCGQEFALDKAISYIKGRMIVTSSLKTPFQFADSVIGLIKAPEQTS
DESKNPENSTLLTRTPTKGDNHISNVLDDNLLESESTNSLLLLRENASTYGRSPSGFRPR
YSITSASLNPRHQRRKSDTISTSRRPAKSFSFSVASPTSRMLRQSSKINGHPPPILQKKT
SMGRLMFPMDAKTYDPESHELIPHSASIETPAMVDKKLHFGRKSRYLRHMNKKWVSSSNI
LYTDSDKEDHPTLRLISNFDSDAMIHSDLAGNFRRHSIDGRPPSQATKSSPFRSRPSSST
QHKSTTSFTQ
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaaatatcagatcttacatctacacaaaataagcccctccttgttacgcaa
caactaatcgaaaaatattacgaacagatcctgggcacttcccagaacataattcctatt
ttaaatccgaagaacaagtttattaggcccagtaaggataattcagatgttgaaagggtg
gaggaggatgctggtaaaagactgcaaactggcaagaacaaaactacgaacaaagtaaat
ttcaacctggatactggaaacgaggataaacttgacgatgaccaagagacagtaacagaa
aatgaaaataatgatatcgagatggttgagacagacgaaggcgaagatgaaaggcaaggg
tcatctttagccagtaaatgcaaatcatttctttacaacgtttttgtgggaaactatgaa
agagacattcttattgacaaagtctgttcacaaaagcaacatgcgatgtcatttgaagaa
tggtgttctgcgggcgccagattggatgacctcactgggaaaacagaatggaagcagaaa
ttggaaagtcccttgtatgattacaagctaataaaagatttaacatctagaatgcgtgag
gagcgcttgaataggaattacgctcaattgttgtacatcattaggacgaattgggtacga
aacctgggaaatatggggaatgtaaacctatataggcactcccatgtaggcaccaaatat
ttaattgacgagtatatgatggagtctaggttagcgctagaatctttaatggagtctgat
cttgatgatagttaccttttgggtatactgcaacaaacgagaagaaatattggtcgtacc
gctttagttctcagtgggggtggaacttttggtcttttccacatcggtgtccttggtact
ctatttgaattggatttattacccagagtgattagtggtagcagtgctggtgcaattgta
gcaagcatattatctgtccatcacaaagaagaaattccggttttactaaatcatattttg
gataaagaattcaacattttcaaagacgataaacagaaaagtgaaagcgagaatttgtta
ataaaaatatctaggttcttcaaaaacggtacgtggtttgataacaagcatctggtaaat
acaatgatagaatttttgggagatttgacatttagggaagcttacaatagaacgggtaaa
attttgaatataaccgtttcgccggcatctttatttgaacaaccgcgcttgctgaataat
ttgactgcaccaaacgtcctgatttggtccgccgtatgtgcatcatgttcactaccggga
attttcccctcgagcccactttacgaaaaagatccaaaaacgggagaaaggaaaccatgg
actggtagtagttcggtcaaatttgtcgatggttctgtggacaatgacttgcccatttct
cgtctttctgaaatgtttaatgtagaccatattatcgcatgccaggtgaatattcacgta
tttccctttttgaaactatcactatcctgtgttggcggggaaattgaggacgaatttagt
gcaagattaaagcaaaacttatcaagtatatacaattttatggccaatgaagctattcat
attctagaaattggaagtgagatgggaattgccaaaaacgcgcttacaaaactgagatcg
gtattatctcaacaatattctggtgacatcactattttgcccgacatgtgtatgcttttt
agaataaaggagctgttgtcaaacccaacaaaagaatttttattaagggaaatcaccaat
ggtgcaaaagctacgtggcccaaggtttccattattcaaaatcactgtggccaggaattt
gctctggataaggcgatttcttatatcaaaggtaggatgattgtcacctcctctttaaaa
acccccttccaatttgctgattcagtcattggattaattaaagctccagagcaaacgtca
gatgagtccaaaaacccagaaaattcaacattgctaactaggactccaaccaagggtgac
aatcatatttccaatgttttagatgacaacttattagaatcagaatcgacaaactctttg
ctattgttacgtgagaatgcaagcacatatgggcggtcaccttccgggtttagaccgcgg
tattccattacgtccgcttctctcaatccgcgtcaccaaagaaggaaatcagatactatt
tcaacttcaaggcgaccagccaaatccttttcattttcagttgcttctcccacatcaagg
atgttgaggcaatccagcaaaatcaatggacacccaccgccaattctgcagaaaaaaaca
agtatgggccggctaatgtttcctatggatgccaagacctatgacccggaaagccatgaa
cttatcccacattctgccagcattgaaacacctgccatggtagacaagaaattgcatttt
ggccgaaagagtagatacttgaggcatatgaacaaaaaatgggtcagcagtagcaacata
ttatacacagattcggataaagaagaccatcctacattgagactgataagtaacttcgat
tcagacgcaatgattcatagtgatttagcgggcaatttcaggcgtcatagcattgatgga
agacccccttctcaagctacaaagagctcaccgtttcgatcgaggccttcttcttcaacg
cagcacaaaagcaccaccagttttactcaataa

DBGET integrated database retrieval system