KEGG   Saccharomyces cerevisiae (budding yeast): YKR092CHelp
Entry
YKR092C           CDS       T00005                                 

Gene name
SRP40
Definition
(RefSeq) Srp40p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP40_C
Motif
Other DBs
NCBI-GeneID: 853967
NCBI-ProteinID: NP_013018
SGD: S000001800
UniProt: P32583
Position
XI:complement(612665..613885)
Genome map
AA seq 406 aa AA seqDB search
MASKKIKVDEVPKLSVKEKEIEEKSSSSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSS
SSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESSSES
ESEDETKKRARESDNEDAKETKKAKTEPESSSSSESSSSGSSSSSESESGSESDSDSSSS
SSSSSDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDSDSDS
SSDSDSSGSSDSSSSSDSSSDESTSSDSSDSDSDSDSGSSSELETKEATADESKAEETPA
SSNESTPSASSSSSANKLNIPAGTDEIKEGQRKHFSRVDRSKINFEAWELTDNTYKGAAG
TWGEKANEKLGRVRGKDFTKNKNKMKRGSYRGGSITLESGSYKFQD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagaaaattaaagttgacgaagtgccaaaattaagtgttaaggagaaggag
attgaagagaaatcttcttcttcttcttcctcctcctcctcctcctcctcctcctcttct
tcttcatcttcctcgtccagttctagcggcgaatcttcaagcagcagcagcagcagcagc
agcagcagcagcagtgacagcagtgacagcagtgactctgaatctagctcatcatcatct
tcttcttctagctcaagctcaagttccagtgactctgaatcttctagtgaatccgactct
agctccagtggatcttcttcttcctctagctctagttctgacgaatcttcttcggaatcc
gaatcagaagatgaaaccaagaaaagagcaagagaatcagacaacgaagatgctaaggag
actaaaaaggctaaaactgaaccagaaagctcttcctcatcggagtcaagctctagcggg
tcatcgtcatcttcagaatcagaatcaggttcggaatctgattctgactcaagttctagc
tcaagtagttcttctgattccgaatcagattctgaatcagattctcaatcaagttctagc
tccagctctagcgactcttcgtctgactccgactccagctccagcgactcttcatctgac
tccgactctagctccagctctagcagctcttcctcggattcagattcggattccgactca
agctcggactcagactcttcaggctcgtccgattcttcaagctcgtctgattcaagttcc
gacgaatctacatcttctgattcctccgattcggattccgactcagactctggttctagc
tctgaattggaaacaaaagaagcaactgcagacgaatccaaggccgaagaaacgcctgcc
tcatctaacgaatcaactccatctgcttccagttcatcaagcgccaataaattgaacatt
cctgctggaaccgacgagatcaaagagggccaaagaaagcatttttccagagtagataga
tcgaagattaatttcgaagcttgggagttgacagacaacacctacaaaggcgcggctgga
acatggggtgaaaaggcaaatgaaaaattaggtagagtaagaggtaaagatttcacgaag
aacaaaaataaaatgaagagaggttcttacagaggtggatccattacattagaaagtggt
tcatacaaattccaagattaa

DBGET integrated database retrieval system