KEGG   Saccharomyces cerevisiae (budding yeast): YKR093WHelp
Entry
YKR093W           CDS       T00005                                 

Gene name
PTR2
Definition
(RefSeq) Ptr2p
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    YKR093W (PTR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-GeneID: 853968
NCBI-ProteinID: NP_013019
SGD: S000001801
UniProt: P32901
Position
XI:615730..617535
Genome map
AA seq 601 aa AA seqDB search
MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDF
EGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS
LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
GNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL
QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI
GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI
YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP
ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE
IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTK
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaccatcccagccaaggctcagatgatgctcaggacgaaaagcaaggcgacttc
ccggtcatcgaagaggagaagacccaggctgtaacgctgaaggattcgtatgttagcgac
gacgtcgccaactccacggaacgctacaacttgtccccttctccggaggacgaagacttc
gaaggccccactgaagaagaaatgcagactttaaggcacgttggtggtaaaattcctatg
aggtgttggttaattgctattgtagagctttccgagagattctcctactacgggctttcc
gcaccattccaaaactacatggaatatggacctaatgactccccaaagggtgttctgagc
ttgaacagtcagggtgccactgggttgtcgtattttttccagttttggtgttacgttaca
ccagttttcggtggttacgttgcggacaccttctggggtaaatataatacaatttgttgc
ggtaccgctatttacattgccggtattttcattctatttatcacttcgattccctccgtt
ggtaacagagacagtgctattggtgggttcattgctgccattattctgatcggtattgcc
actggtatgattaaagctaacctttccgtgttgattgccgaccagcttcctaagcggaaa
ccctccatcaaagttttaaaatcgggcgaaagagtcattgtcgattcaaatattacttta
caaaacgtttttatgttcttctatttcatgatcaatgtcggttctctatcattaatggcc
actactgaattggaatatcataaggggttctgggcggcctatctattgcccttctgcttc
ttttggatcgctgttgtcactttgatttttggtaaaaagcaatacattcaaagaccaatc
ggagataaagtcatcgctaaaagttttaaagtttgttggattttaactaagaataagttc
gacttcaacgctgctaaaccttctgttcatccagaaaagaactatccatggaatgacaaa
tttgttgatgaaattaagagagctttggcggcttgtaaagtctttatattctacccaatt
tattggacccaatacggtaccatgatttccagtttcatcactcaggccagtatgatggaa
ttacatggaattcccaacgatttcttacaagcattcgattccattgcgttgatcattttc
atcccaatttttgaaaaattcgtatatcctttcattagaagatacactccactaaaacca
attacaaaaattttcttcggtttcatgtttggatcttttgccatgacatgggctgctgtt
ctacaaagtttcgtttacaaggctggtccatggtataatgaacctctgggtcacaacacc
ccaaatcatgtccacgtttgctggcaaatacccgcatatgtcttgatttctttttcagag
atctttgcctctatcactgggttggaatacgcttattccaaagccccagcttccatgaaa
tcgtttattatgtccattttcttattgactaacgcctttggttctgcaatcggttgtgca
ttgtccccagtgaccgttgatcctaaatttacatggttattcactggtttggctgttgcc
tgctttatttctggttgtttgttctggttgtgcttcaggaagtataatgatacagaggaa
gaaatgaacgctatggactacgaagaagaagacgaatttgatctcaatccaatttccgca
cctaaagctaacgatattgaaatattagaaccaatggaaagtctaagatccaccaccaaa
tattag

DBGET integrated database retrieval system