KEGG   Saccharomyces cerevisiae (budding yeast): YKR095WHelp
Entry
YKR095W           CDS       T00005                                 

Gene name
MLP1, MPL1
Definition
(RefSeq) Mlp1p
  KO
K09291  nucleoprotein TPR
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YKR095W (MLP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YKR095W (MLP1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YKR095W (MLP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_MLP1_2
Motif
Other DBs
NCBI-GeneID: 853970
NCBI-ProteinID: NP_013021
SGD: S000001803
UniProt: Q02455
Position
XI:619805..625432
Genome map
AA seq 1875 aa AA seqDB search
MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN
LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL
EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE
TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR
NELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQ
RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKE
CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI
INSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL
CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII
QLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRI
EELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL
LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT
ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSL
RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN
IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI
NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD
EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES
KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ
LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG
PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHS
SIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTA
LKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKER
QGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQN
AKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQR
QIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNI
NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVE
ERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKL
RAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPP
KSVNNVQNPLLGLPRKIEENSNSPFNPLLSGEKLLKLNSKSSSGGFNPFTSPSPNKHLQN
DNDKRESLANKTDPPTHLEPSFNIPASRGLISSSSTLSTDTNDEELTSNNPAQKDSSNRN
VQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDEDDTTENINESKKIKTED
EEEKETDKVNDENSI
NT seq 5628 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatcatgatactccaatggaaagcatacaaaatggtgaaaattcagacgaaaga
ttgaacgccattgcgtcttttttcggttgctctttagagcaggttaaatcatttgacggt
gatgtggtaaaacaccttaacgataaacttttacagtttaatgaacttaaatcggagaat
ctaaaggttaccgtctcattcgatgaattgaaggctagttctttaaagaaaattgatggt
ttgaagacagaaatggaaaacgttataagagaaaatgataaaatccgaaaagagaggaat
gatacttttgttaagttcgaatctgtagaaaatgaaaagatgaaattatcaagtgagcta
gagtttgtgaaaaggaagctcgatgatttaactgaggagaaaaaggaaacccagagtaat
caacagcgaaccctgaaaatactggatgaaagactaaaagaaatagaattggtcagggtt
gagaataatcgctccaatagtgaatgtaagaaactacgctctacaataatggatttagaa
acaaaacaacagggctatattactaatgacctgaattctagaactgaactggaaagaaaa
acacaagaattgactttattgcagtcaaataatgattggctagaaaaggagctacgttca
aaaaatgaacagtatctctcctacagacaaaaaaccgacaaagtaattctagatatcagg
aatgaattaaatcgtttaaggaatgattttcaaatggaaagaacgaataatgatgttttg
aagcaaaaaaataacgaattgtcaaaatctttacaagaaaaactactggaaatcaagggt
ctatccgactccctaaattccgaaaagcaagaattttctgcagaaatgtccctaaagcaa
cgtttagtggaccttttagaatcacaattgaacgctgtaaaagaagaattgaacagtata
agagagttgaacactgcaaaggtaatagcagatgattcaaaaaaacaaactcccgaaaat
gaagacttacttaaggaattgcagttaacgaaagaaaaattagcacaatgcgaaaaagaa
tgtctacgtttatcctctataactgacgaagcagatgaagataatgaaaatttatctgca
aaatctagttctgattttatattcctgaagaaacaattaattaaagaaaggcgtaccaag
gaacatcttcaaaatcaaattgaaacattcatcgtagagttggaacataaagtgcccatt
ataaactctttcaaagaaagaactgacatgttggaaaacgaattgaataacgctgcattg
ttactagagcatacatcgaacgagaagaatgcaaaggttaaggaattaaatgccaaaaac
caaaagctagtggaatgtgaaaatgatcttcaaactttaactaaacaacgtctcgatcta
tgccgtcaaatacaataccttttaattaccaattctgtttctaatgactcgaagggaccc
ttacgtaaggaagaaattcaatttattcaaaacattatgcaggaagacgatagtactatc
acagaatctgactctcaaaaagtcgtaactgaaagactagttgaattcaaaaacattatt
caattacaagaaaaaaatgcagaacttttgaaagtagtaagaaacttagccgataagttg
gaatcgaaagaaaagaaatctaaacaaagtcttcagaaaatcgaaagtgaaacagtaaat
gaggctaaagaggctataataactttaaagagtgaaaaaatggatctagaatcaagaatt
gaggaactacagaaagagcttgaagaattgaaaacttctgttcccaacgaagatgcgtca
tacagcaatgtaactataaaacagttaaccgaaactaagagagacctcgaatctcaagta
caagacttgcaaactcgtatctcgcaaattactagggagtctactgaaaatatgtcactt
ttaaacaaggagatacaggacctgtatgacagcaagagcgacatatccattaagcttgga
aaggaaaaatcatcgagaatattggcagaggaacgatttaaactactttcgaatacgtta
gatctaactaaagctgagaacgaccaactgcgcaaaaggtttgattatttacagaatact
attttaaaacaagattccaaaacacacgagacacttaatgaatacgtttcctgtaaatct
aagttaagcattgttgaaacagaattattgaacctgaaagaagaacagaaattaagagtt
catttagaaaagaacttgaaacaagaactgaataaactctcccctgaaaaggacagttta
cgcatcatggtaactcaattacaaactttacaaaaggagcgtgaagatctattggaagag
actaggaaatcatgtcaaaagaaaatagatgaacttgaagatgctctcagcgaacttaaa
aaggaaacttctcaaaaagaccatcatatcaaacagctggaagaagacaacaattcaaat
atagaatggtaccaaaataaaatcgaagctttgaagaaagattatgaatcagtaataact
tctgtagatagtaagcaaactgacattgagaaattacaatataaagtcaaatcactagaa
aaggaaatcgaggaggacaagattcgtttacatacttataatgttatggatgaaacaatt
aacgatgattccctacgcaaggagttggaaaaatccaagattaacttaactgatgcttat
tcacaaatcaaagaatacaaggatctctacgagactacctctcagtctttgcagcaaacg
aattctaaattggatgaatctttcaaggactttactaaccagattaaaaacctaactgat
gaaaaaactagtttggaggataagatttcgcttctaaaagagcaaatgtttaatttgaat
aatgagctagatttgcagaaaaaagggatggaaaaagaaaaagctgactttaagaaaagg
atatcaattttacagaacaataataaagaagtcgaagctgttaagtccgaatatgaatcg
aagttatcaaaaatccaaaacgaccttgatcaacaaactatatatgctaatactgcgcaa
aacaactatgaacaagaactacagaaacatgcagatgtttctaagacgattagtgaatta
agagagcaattacatacgtacaaaggtcaagttaagaccctgaacttatcgcgtgatcaa
ctggagaatgctctgaaagaaaacgaaaagagttggtcctcccagaaggaatctttatta
gaacagctagatttatcgaattctcgtattgaggatttatcctcccaaaataaactattg
tatgatcaaatacaaatctacacagctgcggacaaagaagtcaataattcgacaaacgga
cctggtttgaataatattttaattacactacgtcgcgaaagggatattcttgatacaaaa
gtgacggtggctgaaagagatgcaaaaatgttgagacaaaaaatttctttgatggatgtt
gaattacaagatgctcgtactaagctagataattcaagagttgaaaaggaaaatcattct
tccattattcaacagcatgacgacattatggagaaattaaatcaattaaatctattaaga
gaaagtaacataacattgcggaatgagctggaaaacaacaataacaagaagaaggaactg
caatctgaattagataaattgaagcaaaatgttgcgcctatcgagtccgaattgacagcc
ttgaaatattctatgcaagaaaaagagcaagagctcaaattagctaaagaagaggttcat
cgttggaaaaagcgctcacaagacatattggagaaacatgaacaattgagctcaagcgat
tatgagaagctagaaagcgagatagaaaatttgaaggaggaactagaaaataaggagcgt
caaggagcggaagccgaggaaaaatttaacaggctgagaagacaagcgcaagagagatta
aaaacatcaaaactctcacaggactcattgactgaacaagtaaatagtctaagggatgca
aagaacgtgttggaaaattccttgagtgaggcaaacgcgagaatcgaagagttacaaaat
gcaaaagtagcacaaggtaacaaccagttagaagcaataagaaaattacaagaagacgca
gaaaaggcttcaagagagcttcaagccaagttagaagaaagtacgacttcttacgaatct
acgataaacggcttaaatgaagagattacaacattaaaagaagaaattgaaaaacaaagg
caaatccagcaacagttacaagctacatctgcaaatgaacaaaatgacttatctaacata
gttgagtctatgaaaaagtcttttgaagaagataaaatcaaattcatcaaagaaaaaacc
caagaagttaatgaaaaaatactcgaggcccaagaaaggctaaatcaaccttccaatatc
aatatggaggagattaaaaaaaaatgggaatctgagcacgaacaggaagtatctcaaaag
attcgcgaagctgaggaagccctcaaaaagcgaatcagattacccactgaggagaaaatt
aataagataatcgaacgaaagaaggaggaattggaaaaagagtttgaagaaaaggttgag
gagagaataaaatcaatggaacaatctggagaaatagacgtggtgcttcgaaaacagcta
gaagctaaggttcaagagaaacaaaaggaattggaaaacgagtataacaaaaaattacaa
gaagaactcaaagatgtaccacactcaagtcatatctcagatgatgaaagggacaaatta
cgagcagaaatcgaaagcaggttgagggaggagttcaacaatgaactgcaagccataaag
aagaaatccttcgacgaaggaaagcaacaagcaatgatgaaaactacccttttggaaaga
aaacttgccaagatggaatctcaattgtcagaaacaaaacaaagtgccgagagtcctccg
aaatctgttaacaatgtacaaaatccattactaggattacctaggaaaatcgaagagaat
tcaaattcaccattcaatccgttactttccggtgaaaaactcttaaagctaaattctaag
tcttcatcaggtggatttaacccttttacctcgccatccccaaataagcacttacaaaat
gataatgacaaaagggagtcgttggctaacaagacagatccaccaactcatttggaaccc
agcttcaacattcccgcctcaaggggtctaatatcttcatcttccactttgtcaactgat
acaaatgatgaagaacttactagcaacaatcctgcccaaaaggattcatcgaacagaaat
gttcaatcggaagaggatacagaaaaaaagaaagagggagaacctgttaaaagaggagag
gcaatagaagagcagacgaaatccaacaagcgacctattgatgaggtaggagagctgaaa
aatgatgaagacgacactacagaaaacattaatgagtcaaaaaagatcaagactgaagat
gaggaagaaaaagaaaccgataaggtgaatgacgagaacagtatataa

DBGET integrated database retrieval system