KEGG   Saccharomyces cerevisiae (budding yeast): YKR099WHelp
Entry
YKR099W           CDS       T00005                                 

Gene name
BAS1
Definition
(RefSeq) Bas1p
  KO
K09423  Myb-like DNA-binding protein BAS1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YKR099W (BAS1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-like factors
    YKR099W (BAS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 853974
NCBI-ProteinID: NP_013025
SGD: S000001807
UniProt: P22035
Position
XI:635851..638286
Genome map
AA seq 811 aa AA seqDB search
MSNISTKDIRKSKPKRGSGFDLLEVTESLGYQTHRKNGRNSWSKDDDNMLRSLVNESAKE
LGYENGLEDVKTIQQSNHLSKCIAWDVLATRFKHTVRTSKDVRKRWTGSLDPNLKKGKWT
QEEDEQLLKAYEEHGPHWLSISMDIPGRTEDQCAKRYIEVLGPGSKGRLREWTLEEDLNL
ISKVKAYGTKWRKISSEMEFRPSLTCRNRWRKIITMVVRGQASEVITKAIKENKNIDMTD
GKLRQHPIADSDIRSDSTPNKEEQLQLSQQNNPSLIKQDILNVKENESSKLPRLKDNDGP
ILNDSKPQALPPLKEISAPPPIRMTQVGQTHTSGSIRSKVSLPIEGLSQMNKQSPGGISD
SPQTSLPPAFNPASLDEHMMNSNSISDSPKHAYSTVKTREPNSSSTQWKFTLKDGQGLSI
SNGTIDSTKLVKELVDQAKKYSLKISIHQHIHNHYVTSTDHPVSSNTGLSNIGNINGNPL
LMDSFPHMGRQLGNGLPGLNSNSDTFNPEYRTSLDNMDSDFLSRTPNYNAFSLEATSHNP
ADNANELGSQSNRETNSPSVFYPQANTLIPTNSTATNNEIIQGNVSANSMSPNFNGTNGK
APSSTASYTTSGSEMPPDVGPNRIAHFNYLPPTIRPHLGSSDATRGADLNKLLNPSPNSV
RSNGSKTKKKEKRKSESSQHHSSSSVTTNKFNHIDQSEISRTTSRSDTPLRDEDGLDFWE
TLRSLATTNPNPPVEKSAENDGAKPQVVHQGIGSHTEDSSLGSHSGGYDFFNELLDKKAD
TLHNEAKKTSEHDMTSGGSTDNGSVLPLNPS
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatataagtaccaaagatatacgaaaaagtaagccaaaaagaggatccggcttc
gatttacttgaagtgactgaatcacttggctatcagacacacaggaaaaatggaagaaat
tcatggtcaaaggacgacgataatatgctacgatcgctagtaaacgaatccgcaaaggag
ttaggctatgagaatggacttgaagacgtaaaaacaattcaacaatccaaccatctttct
aaatgtattgcttgggatgttttagctacacgattcaaacacaccgtaagaacttcaaag
gatgtaagaaagcgttggacaggatctctggacccaaacttgaagaaaggtaaatggaca
caagaagaggatgagcagctcttgaaagcttatgaagaacatgggcctcactggctgagt
atctccatggatatccctggaagaacagaggatcaatgtgcgaaaaggtacattgaagtg
ttgggacctggaagtaaaggtagattaagagaatggacgctcgaggaagatttaaatctg
ataagtaaagtgaaggcatacggcacgaaatggagaaagatttcgtcggaaatggaattc
agaccaagtttaacgtgcaggaacagatggcggaaaattattactatggttgtgcgagga
caagcatcagaagtaataacaaaggctataaaagaaaacaagaacatagacatgacagac
ggaaaactccgacaacatccaatcgccgattctgatatacgctcagattctacaccgaat
aaagaagaacagttgcagctatctcaacagaacaacccttcattgataaagcaggatata
ttgaatgttaaagagaacgaatcgagcaaactaccaagattaaaggataatgatggaccc
attttaaatgacagcaagccacaagcattacctcccttaaaagagatatctgcacctcca
ccaatcaggatgacgcaagtcggtcagactcataccagtggtagcattaggagcaaagta
tctttaccaattgaaggtctttctcaaatgaacaagcaaagtcctggaggaatctcagat
agcccacagacaagccttcccccagcattcaatccagcatctctcgatgagcatatgatg
aatagtaatagtatttcagattctccgaagcatgcttattctactgtgaaaactagagaa
ccaaattcctctagcacacaatggaaatttacattaaaagatggtcaaggtttgtcaatt
tctaacggaactattgacagcacaaaattagtaaaagaattggttgaccaagctaagaag
tactctttaaaaatttcgatacatcaacatattcacaatcattatgttacatccacagac
catcctgtcagcagcaatactggattgtcaaatataggaaatataaatggaaaccctcta
ttaatggatagtttcccacatatgggtagacaactgggaaatggtcttccagggttaaat
tcaaatagtgacacttttaacccagaatataggacttctctggacaacatggatagcgat
tttttatcaagaacacccaactataacgcattcagcttggaagcaacttcacacaatccc
gctgacaatgcaaatgaacttggttcacaaagcaatagagaaacaaacagcccgtctgta
ttttatcctcaagcaaatacattgatcccaactaattctaccgctacaaataatgaaatc
attcaaggaaacgttagtgctaatagtatgtcaccgaatttcaatggaacaaatggcaag
gcaccaagttcgacggcatcatatacaacgagcggttcagaaatgccacctgatgtaggt
cctaatagaatagcgcatttcaactatttgccaccaactatacggcctcatttaggctca
tcagatgcgacaagaggtgctgacttgaataagttactcaatccatctccaaattcagta
agaagtaacggcagtaaaactaagaaaaaagaaaaaagaaaaagtgaatcatctcagcat
cattcttcatcatctgtgacaaccaataaattcaatcacattgatcagtcggagatatca
aggactacatccagatctgatactccattgagagatgaagacggcctggatttttgggaa
acgttaagatccttggctactacgaatccaaatcctccagttgaaaagtcagctgaaaat
gatggtgccaagcctcaagtggtacatcaagggattggctcacatacagaagatagcagc
ctaggttcccatagcggaggatacgatttttttaacgaactgttggataaaaaggcagat
acactgcataatgaggctaagaagacgagcgagcatgatatgacgtcaggaggttctacc
gataatgggtcagtcctgccactgaatcctagttga

DBGET integrated database retrieval system