KEGG   Saccharomyces cerevisiae (budding yeast): YLL004WHelp
Entry
YLL004W           CDS       T00005                                 

Gene name
ORC3
Definition
(RefSeq) origin recognition complex subunit 3
  KO
K02605  origin recognition complex subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Module
sce_M00284  Origin recognition complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLL004W (ORC3)
   04113 Meiosis - yeast
    YLL004W (ORC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YLL004W (ORC3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLL004W (ORC3)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YLL004W (ORC3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YLL004W (ORC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ORC_WH_C ORC3_N
Motif
Other DBs
NCBI-GeneID: 850656
NCBI-ProteinID: NP_013097
SGD: S000003927
UniProt: P54790
Structure
PDB: 

Position
XII:141073..142923
Genome map
AA seq 616 aa AA seqDB search
MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWEL
YHQLHSHFHDQVDHIIDNIEADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKD
ESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHPTIKYEDINDEDGDFTEQNND
VSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNI
NTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVE
FILSKMANNTNHNLQLLTKMLDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTF
MFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVRENPINGHAKFVARFLEEELNIT
NFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIF
PSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDF
YIAFRETLPKEEILNFIRKDPSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQ
STKSYDLVEKCVWRGI
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccttaaccaatccaaaaagatgaacgtcagcgagtttgctgacgcccaaagg
agccactatacagtataccccagtttgcctcaaagtaacaaaaatgataaacacattccc
tttgtcaaacttctatcaggcaaagaatcggaagtgaacgtggaaaaaagatgggaattg
tatcatcagttacattcccactttcatgatcaagtagatcatattatcgataatattgaa
gcagacttgaaagcagagatttcagaccttttatatagtgaaactactcagaaaaggcga
tgctttaacactattttcctattaggttcagatagtacgacaaaaattgaacttaaagac
gaatcttctcgctacaacgttttgattgaattgactccgaaagaatctccgaatgtaaga
atgatgcttcgtaggtctatgtacaaactttacagcgcagctgatgcagaagaacatcca
actatcaagtatgaagacattaacgatgaagatggcgattttaccgagcaaaacaatgat
gtatcatacgatctgtcacttgtggaaaacttcaaaaggctttttggaaaagacttagca
atggtatttaattttaaagatgtagattctattaacttcaacacattggataacttcata
attctattgaaaagtgccttcaagtatgaccatgttaaaataagtttaatctttaatatt
aatacaaacttgtcaaatattgagaaaaatttgagacaatcaaccatacgacttctgaag
agaaattatcataaactagacgtgtcgagtaataaaggatttaagtacggaaaccaaatc
tttcaaagctttttggatacggttgatggcaaactaaatctttcagatcgttttgtggaa
ttcattctcagcaagatggcaaataatactaatcacaacttacaattattgacgaagatg
ctggattattcgttgatgtcgtactttttccagaatgccttttcagtattcattgaccct
gtaaatgttgattttttgaacgacgactacttaaaaatactgagcagatgtcctacattc
atgttctttgtcgaaggtcttataaagcagcatgctcctgctgacgaaattctttcatta
ttgacaaacaaaaacagaggcctagaagagttttttgttgagtttttggtaagagagaac
ccgattaacgggcatgctaagtttgttgctcgattcctcgaagaagaattgaatataacc
aattttaatctgatagaattatatcataatttgcttattggcaaactagactcctatcta
gatcgttggtcagcatgtaaagagtataaggatcggcttcattttgaacccattgataca
atttttcaagagctatttactttggacaacagaagtggattacttacccagtcgattttc
ccttcttacaagtcaaatatcgaagataacttactaagttgggagcaggtgctgccttcg
cttgataaagaaaattatgatactctttctggagatttggataaaataatggctccggta
ctgggtcagctattcaagctttatcgtgaggcgaatatgactatcaacatttacgatttc
tacattgcgttcagagaaacattaccaaaagaggaaatattaaatttcataagaaaagat
ccctccaacaccaaactcttagaactagcagaaacaccggacgcatttgacaaagtagca
ctaattttattcatgcaagcaatcttcgcctttgaaaacatgggtctcattaagtttcaa
agcaccaagagttacgatctggtagaaaaatgtgtctggagaggaatttag

DBGET integrated database retrieval system