KEGG   Saccharomyces cerevisiae (budding yeast): YLL008WHelp
Entry
YLL008W           CDS       T00005                                 

Gene name
DRS1
Definition
(RefSeq) putative ATP-dependent RNA helicase
  KO
K13181  ATP-dependent RNA helicase DDX27 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YLL008W (DRS1)
   03009 Ribosome biogenesis [BR:sce03009]
    YLL008W (DRS1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YLL008W (DRS1)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    YLL008W (DRS1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    YLL008W (DRS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C
Motif
Other DBs
NCBI-GeneID: 850652
NCBI-ProteinID: NP_013093
SGD: S000003931
UniProt: P32892
Position
XII:131729..133987
Genome map
AA seq 752 aa AA seqDB search
MVVGTKKYSNLDFVPTISDSEDDVPILDSSDDEKVEAKKTTKKRKGKNNKKKVSEGDNLD
EDVHEDLDAGFKFDLDADDTTSNFQGWNFLAEGESNKDDAEAFVKKDVDLDKIIRRKGGL
VKMAHIDSKQEEETEKEKVEKENDSDDEELAMDGFGMGAPMNNGDENQSEEEEEEEEKEE
EEEEEEEQEEMTLEKGGKDDEIDEEDDSEEAKADFYAPETEGDEAKKQMYENFNSLSLSR
PVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKI
ASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIAT
PGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMN
SKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKLDPTGQK
RIVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLAS
RGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGESSQDRSIVRAAIKSV
EENKSLTQGKALGRNVDWVQIEETNKLVESMNDTIEDILVEEKEEKEILRAEMQLRKGEN
MLKHKKEIQARPRRTWFQSESDKKNSKVLGALSRNKKVTNSKKRKREEAKADGNGARSYR
KTKTDRIADQERTFKKQKSTNSNKKKGFKSRR
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggtggtaggaactaaaaaatactctaatttggactttgtccctacaatcagtgacagt
gaagacgatgttccaattctagattcttctgatgacgaaaaagtcgaggctaagaagact
acgaagaagcggaagggtaagaataacaagaaaaaggttagtgagggggataacctcgat
gaggatgttcatgaggacttggacgcggggtttaagtttgatttggacgccgatgatacc
acttcgaacttccaaggctggaactttctagcagagggcgagtccaataaggacgatgcc
gaagcttttgtgaagaaggacgttgacttggataagattattagaagaaaaggtgggctg
gtgaaaatggcccatattgatagtaaacaagaagaagaaaccgagaaagaaaaagtagaa
aaagaaaacgatagcgacgatgaggaattagcaatggacgggttcggtatgggagctccc
atgaacaatggagacgaaaatcagtcagaagaagaagaagaagaggaggaaaaggaagag
gaagaggaggaagaggaggaacaagaagagatgacgttagaaaaaggcggcaaagatgac
gaaatagatgaagaagacgattctgaagaggcaaaagccgatttctatgcgcctgaaact
gagggagatgaagctaaaaagcaaatgtacgaaaatttcaacagtttgtctttatctcgt
ccggttcttaagggccttgcaagtttgggttacgtcaagccttcccctattcaaagcgcc
acaatccccattgccttattgggtaaagacatcattgccggtgctgtgactggttccggt
aagactgctgcgtttatgattcccataatcgagcgtttgttgtataaaccagccaaaatc
gcttccaccagagttattgttctattgcccactcgtgagttagctatccaagtcgctgac
gttggtaaacaaattgcacgtttcgtctccggtataacctttggtctggccgttggtggt
ttgaacttgagacaacaagaacaaatgttgaaatctcgtccggacatcgtcattgctacc
ccaggtagattcattgatcatatcaggaactcagcaagttttaatgtggactcagtagag
attctggttatggatgaagccgatagaatgttagaagaaggttttcaagatgaactgaac
gaaattatgggcctattaccaagcaatagacagaacctattgttttctgctacaatgaac
tccaaaattaaaagtttagttagtctttctctaaaaaaaccagtaaggattatgattgat
cctccaaagaaagctgctactaagttgacacaagaattcgttcgtattcgtaaaagagac
catttgaagcctgccttgttatttaatttgattaggaaattggatccaacgggtcaaaag
aggattgtcgtttttgtggctagaaaagaaactgctcataggttaaggattatcatgggt
cttttaggtatgagtgtgggtgaattacacggttctttaacccaagaacagcgtttagat
tccgttaataaattcaaaaatttggaagttcctgtacttatctgtacggatttggcctcc
agaggtcttgatatccccaagattgaggttgttatcaactacgatatgcccaagagttat
gagatctacctgcatagagttggtcgtaccgccagagctggtagggaaggtcgttccgtc
accttcgtcggtgaatcatctcaagatagaagtattgtacgtgctgctataaagagtgta
gaagaaaataagtccctaactcaaggtaaagcacttggtagaaacgtagactgggttcaa
atcgaagaaacaaacaaacttgttgaatccatgaacgatacgattgaagatattctggtg
gaagaaaaggaggagaaggaaatattaagggctgaaatgcaattaagaaagggtgaaaat
atgttgaagcataaaaaggaaatccaggcaagaccaagaaggacatggttccaaagcgaa
tcagataagaaaaattccaaagtattaggtgctttatcaaggaacaagaaagtcactaac
agcaaaaagagaaagcgtgaagaagctaaggcagatggcaatggtgcacgttcttataga
aaaaccaaaaccgaccgtattgcagatcaagaaagaacttttaaaaagcagaagagtaca
aattcaaataagaagaagggcttcaaaagccgtaggtaa

DBGET integrated database retrieval system