KEGG   Saccharomyces cerevisiae (budding yeast): YLL011WHelp
Entry
YLL011W           CDS       T00005                                 

Gene name
SOF1
Definition
(RefSeq) rRNA-processing protein SOF1
  KO
K11806  DDB1- and CUL4-associated factor 13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YLL011W (SOF1)
   04121 Ubiquitin system [BR:sce04121]
    YLL011W (SOF1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    YLL011W (SOF1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     YLL011W (SOF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sof1 WD40 ANAPC4_WD40 Ge1_WD40 BBS2_Mid
Motif
Other DBs
NCBI-GeneID: 850649
NCBI-ProteinID: NP_013090
SGD: S000003934
UniProt: P33750
Structure
PDB: 

Position
XII:127523..128992
Genome map
AA seq 489 aa AA seqDB search
MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKLERMFAKPFVG
QLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ
PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES
AFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGS
DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV
FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDS
KYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMPEIKRISRHRHVP
QVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERKKQIVGTVHKYEDSGRDRKRRKE
DDKRDTQEK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaagaccattaaaagaagtgctgatgactatgtccctgttaaaagtacgcag
gaatctcaaatgcccaggaatttgaaccctgaattgcatccttttgaaagggcacgtgaa
tatactaaagctttgaatgccaccaaattggaaagaatgtttgctaaaccctttgtgggt
cagttaggatacggtcatagagatggtgtttatgctattgccaaaaattatggtagtctg
aataaattggctactggttctgcagatggtgtgattaaatactggaacatgtctactaga
gaagaatttgtttcctttaaggcgcattatggactcgttactggtctttgtgtgacacag
cctcgttttcatgacaagaagccagatttgaagagccaaaattttatgttatcttgcagt
gatgacaaaactgtcaagctatggtcaataaatgttgatgattactccaataaaaactcc
agtgataacgactccgttactaacgaggaaggtttgattcgtacttttgacggtgaatct
gcatttcaaggtatcgattcgcacagagaaaactccacgtttgccacaggtggggccaag
atccatctttgggacgttaacagattgaagccagtttccgatctatcatggggagcagac
aacattactagtttaaaattcaatcaaaatgaaacagatatcttggccagtactggtagt
gataattctattgttctttacgacttgagaaccaactcccccacacaaaagattgttcaa
acaatgaggacgaatgctatttgctggaatccaatggaggccttcaactttgtaactgcc
aatgaagatcataacgcctactattatgatatgaggaatttatcacgttcattgaatgta
ttcaaagatcacgtcagcgcagtaatggatgttgacttttctcctacgggggatgagatt
gttactggttcgtacgataagagtatcagaatatataagacgaatcacggacattcgaga
gaaatttatcatacgaagagaatgcagcatgttttccaggttaaatattccatggattct
aaatatattatcagtggatctgatgatgggaatgttaggctatggagaagtaaagcttgg
gagaggtctaatgtcaaaactactcgtgaaaagaataaattagaatatgacgaaaaatta
aaagaaagatttagacatatgccggagatcaaaagaatcagtagacatagacacgtgcca
caagtcatcaaaaaggctcaggaaattaagaacattgagttgagttctattaagagaaga
gaagctaatgaaaggcgtactagaaaggatatgccatacatttccgaaaggaagaaacaa
atcgttggtaccgtgcacaaatatgaagattcaggaagagataggaaaagaagaaaggaa
gatgacaaacgtgatactcaagaaaagtag

DBGET integrated database retrieval system