KEGG   Saccharomyces cerevisiae (budding yeast): YLL018C-A
Entry
YLL018C-A         CDS       T00005                                 

Gene name
COX19
Definition
(RefSeq) Cox19p
  KO
K18183  cytochrome c oxidase assembly protein subunit 19
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YLL018C-A (COX19)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    YLL018C-A (COX19)
SSDB
Motif
Pfam: CHCH Pet191_N COX17 CX9C
Other DBs
NCBI-GeneID: 850642
NCBI-ProteinID: NP_013082
SGD: S000007245
UniProt: Q3E731
Position
XII:complement(108676..108972)
AA seq 98 aa
MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL
RCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK
NT seq 297 nt   +upstreamnt  +downstreamnt
atgtcagggaacccaggaagctcgctgagcgcattgagacctactccacccgagagaggt
tcgttcccgctagaccacgacggcgaatgcaccaagtacatgcaagagtatctcaaatgt
atgcagcttgtgcagaacgaaaatgcaatgaattgtagactactggcaaaggactacctg
cggtgcaggatggaccaccaattgatggactacgatgaatggtcacatttaggtcttcct
gaggatgctccaggcaacaacggtaaaaccataaaagacgccaccgataataaatag

DBGET integrated database retrieval system