KEGG   Saccharomyces cerevisiae (budding yeast): YLR004C
Entry
YLR004C           CDS       T00005                                 
Symbol
THI73
Name
(RefSeq) Thi73p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 850690
NCBI-ProteinID: NP_013104
SGD: S000003994
UniProt: Q07904
Position
XII:complement(157934..159505)
AA seq 523 aa
MKNMSQRSMDVEKKAANADSCSVSTSSINVDDADVALRFLKQNGLDESSTANEDDVVAGE
EANFYGSHELSPKVLRKVDLFILPFLCCTYLLMFLDKALLNYAASMGIKDHLKGNEFSNL
GTIFSAAYIFMEPVVTYLIQKFPISKILGTFITVWGIVLACHAACKTYASLMVVRTLLGL
FESSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLISFGFLHYHGTAFTSWQI
MFLVVGLVTVAFGVLTFLYLPDNVTNAWFLNKEEKIQVVEHIRANQTGLETKKFKKQQVK
ELFLHDKFTWPMLLLTACSQISTGAIGTFSVTITGTFGFDKYETALLQLPIGAITAMIIL
ITTQMLSRWGHITLITTSMYIPAIIGCIVLISLPLSHKIGNLFSLYLLYSGSCVITNIYI
WNSCNTSGYTKRVFRNAITMIVYNVSCIIAPQMFRAYSAPRYIPAKIALLVTQCVCVPLQ
LYIGYICKKENEKRDKEQEGQERKKYQFLDLTDIENRNFRYIY
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgaaaaacatgtcacaacgatccatggacgtggagaagaaggcagctaacgctgatagt
tgttccgtaagtacctcgagcattaatgtagacgatgcggacgttgctttaagattcctg
aaacagaacggtctcgacgaaagctccacggctaatgaagacgatgttgtagcaggcgaa
gaagccaacttctatggttcccatgaattatctcctaaggtcctgagaaaagttgacctc
ttcatcctgccctttttatgctgtacatatcttctgatgtttttggataaggctctgctg
aactacgctgcatctatgggtatcaaagatcatttgaaaggtaacgaattttctaatttg
ggtactatcttttctgctgcttacattttcatggaacctgtggtcacttacttaattcaa
aaattccccatttccaaaatcctaggtacttttattaccgtctggggtatcgtgttggct
tgccatgctgcttgtaagacgtacgcctcgttgatggtcgttcgtactctcctaggtctc
tttgaatcctcgagtgcagttggttgtatcgctattagtggtatgtactatactaaatct
gaacagagtgcaagaattggattctgggccacacaggctggtacaggttatattgtgggc
gggttaatttcttttggctttttacattatcatggtaccgctttcacctcttggcaaata
atgtttttggtcgttggtctggttacagttgcgtttggtgttctaacattcttatacctt
ccagataacgtcaccaatgcttggttcctaaacaaagaggaaaaaattcaagttgttgag
catatcagagctaaccaaactggcctggaaacaaagaagtttaagaagcagcaagttaaa
gaactattccttcatgataagtttacttggccgatgcttttattaactgcatgttctcaa
atttctactggtgccattggtacattttcagtgaccatcactggtacttttggtttcgac
aagtacgaaacagcattactgcagttgcctattggtgccattacggctatgattattctt
ataacaactcaaatgttgtcccgctggggtcatatcacactcataaccacatctatgtat
attccagctattataggttgtatcgttcttatcagtttacccttatcccataagatcggt
aacttattttctctgtacttgctttacagtggttcctgtgtcattaccaatatttacatc
tggaattcatgcaacacctccggttacaccaaaagagtttttagaaatgctattacaatg
attgtatacaatgtctcctgtattattgctccacagatgtttagggcatactctgctcca
cgttacataccagcaaagattgccttattggtcactcagtgtgtttgtgttcccctacaa
ttatacattggctacatttgcaagaaggagaacgaaaagcgtgataaggaacaagaaggt
caagaaaggaagaagtaccaatttttggacttgactgatatcgaaaacagaaatttcagg
tacatttactaa

DBGET integrated database retrieval system