KEGG   Saccharomyces cerevisiae (budding yeast): YLR021W
Entry
YLR021W           CDS       T00005                                 

Gene name
IRC25, DMP2, PBA3, POC3
Definition
(RefSeq) Irc25p
  KO
K11881  proteasome chaperone 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YLR021W (IRC25)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Assembling factors
   Assembling chaperones
    YLR021W (IRC25)
SSDB
Motif
Pfam: POC3_POC4
Other DBs
NCBI-GeneID: 850708
NCBI-ProteinID: NP_013121
SGD: S000004011
UniProt: Q07951
Structure
PDB: 
2Z5B 2Z5C

Position
XII:183623..184162
AA seq 179 aa
MISYEFQTHLPKGKDSSLNASSENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLN
PILDINVPLAGNLGNTGGDYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELY
RRVILPEVSGTMAQDNMQFSLLISMSSKIWRATKEQSADDNDFGKLVFVLKCIKDMYAK
NT seq 540 nt   +upstreamnt  +downstreamnt
atgatatcatatgaattccaaactcatctaccgaaaggaaaagatagctcattgaacgct
tcatccgaaaacaaagaattgtatgtacaagccacgcactttaataacacaattctattg
caaatcagactaaatggggaaatggattccacctatgaggtatcttcaaaaggactaaac
ccaattctcgatatcaacgtaccactggcaggaaacctaggaaacacgggtggcgattat
gacgatgaggaagaagaatttgtaagagaccatttatctgattatcaagtggttaccaag
ttgggagatagtgccgatcctaaagtacccgtggtatgcgtacagattgccgaactatat
aggagagttattctaccagaagtgagcggtacgatggcccaagacaacatgcaattcagc
ttgctgatatccatgagcagtaagatatggagagcaacgaaggaacaaagcgctgacgat
aatgattttggcaaattagtttttgtgttaaagtgtatcaaagatatgtatgcaaagtga

DBGET integrated database retrieval system