KEGG   Saccharomyces cerevisiae (budding yeast): YLR043CHelp
Entry
YLR043C           CDS       T00005                                 

Gene name
TRX1, LMA1
Definition
(RefSeq) thioredoxin TRX1
  KO
K03671  thioredoxin 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YLR043C (TRX1)
Chaperones and folding catalysts [BR:sce03110]
 Protein folding catalysts
  Protein disulfide isomerase
   YLR043C (TRX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_9 Thioredoxin_2 Thioredoxin_8 AhpC-TSA Redoxin DIM1 Thioredoxin_7 TraF OST3_OST6 Phosducin DUF2847
Motif
Other DBs
NCBI-GeneID: 850732
NCBI-ProteinID: NP_013144
SGD: S000004033
UniProt: P22217
Structure
PDB: 

Position
XII:complement(231702..232013)
Genome map
AA seq 103 aa AA seqDB search
MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDEL
GDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggttactcaattcaaaactgccagcgaattcgactctgcaattgctcaagacaagcta
gttgtcgtagatttctacgccacttggtgcggtccatgtaaaatgattgctccaatgatt
gaaaaattctctgaacaatacccacaagctgatttctataaattggatgtcgatgaattg
ggtgatgttgcacaaaagaatgaagtttccgctatgccaactttgcttctattcaagaac
ggtaaggaagttgcaaaggttgttggtgccaacccagcggctattaagcaagccattgct
gctaatgcttaa

DBGET integrated database retrieval system