KEGG   Saccharomyces cerevisiae (budding yeast): YLR044CHelp
Entry
YLR044C           CDS       T00005                                 

Gene name
PDC1
Definition
(RefSeq) indolepyruvate decarboxylase 1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YLR044C (PDC1)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     YLR044C (PDC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 850733
NCBI-ProteinID: NP_013145
SGD: S000004034
UniProt: P06169
Structure
PDB: 

Position
XII:complement(232390..234081)
Genome map
AA seq 563 aa AA seqDB search
MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL
LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS
YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP
ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG
ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI
HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML
PVFDAPQNLVEQAKLTAATNAKQ
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattactttgggtaaatatttgttcgaaagattaaagcaagtcaacgttaac
accgttttcggtttgccaggtgacttcaacttgtccttgttggacaagatctacgaagtt
gaaggtatgagatgggctggtaacgccaacgaattgaacgctgcttacgccgctgatggt
tacgctcgtatcaagggtatgtcttgtatcatcaccaccttcggtgtcggtgaattgtct
gctttgaacggtattgccggttcttacgctgaacacgtcggtgttttgcacgttgttggt
gtcccatccatctctgctcaagctaagcaattgttgttgcaccacaccttgggtaacggt
gacttcactgttttccacagaatgtctgccaacatttctgaaaccactgctatgatcact
gacattgctaccgccccagctgaaattgacagatgtatcagaaccacttacgtcacccaa
agaccagtctacttaggtttgccagctaacttggtcgacttgaacgtcccagctaagttg
ttgcaaactccaattgacatgtctttgaagccaaacgatgctgaatccgaaaaggaagtc
attgacaccatcttggctttggtcaaggatgctaagaacccagttatcttggctgatgct
tgttgttccagacacgacgtcaaggctgaaactaagaagttgattgacttgactcaattc
ccagctttcgtcaccccaatgggtaagggttccattgacgaacaacacccaagatacggt
ggtgtttacgtcggtaccttgtccaagccagaagttaaggaagccgttgaatctgctgac
ttgattttgtctgtcggtgctttgttgtctgatttcaacaccggttctttctcttactct
tacaagaccaagaacattgtcgaattccactccgaccacatgaagatcagaaacgccact
ttcccaggtgtccaaatgaaattcgttttgcaaaagttgttgaccactattgctgacgcc
gctaagggttacaagccagttgctgtcccagctagaactccagctaacgctgctgtccca
gcttctaccccattgaagcaagaatggatgtggaaccaattgggtaacttcttgcaagaa
ggtgatgttgtcattgctgaaaccggtacctccgctttcggtatcaaccaaaccactttc
ccaaacaacacctacggtatctctcaagtcttatggggttccattggtttcaccactggt
gctaccttgggtgctgctttcgctgctgaagaaattgatccaaagaagagagttatctta
ttcattggtgacggttctttgcaattgactgttcaagaaatctccaccatgatcagatgg
ggcttgaagccatacttgttcgtcttgaacaacgatggttacaccattgaaaagttgatt
cacggtccaaaggctcaatacaacgaaattcaaggttgggaccacctatccttgttgcca
actttcggtgctaaggactatgaaacccacagagtcgctaccaccggtgaatgggacaag
ttgacccaagacaagtctttcaacgacaactctaagatcagaatgattgaaatcatgttg
ccagtcttcgatgctccacaaaacttggttgaacaagctaagttgactgctgctaccaac
gctaagcaataa

DBGET integrated database retrieval system