KEGG   Saccharomyces cerevisiae (budding yeast): YLR051CHelp
Entry
YLR051C           CDS       T00005                                 

Gene name
FCF2
Definition
(RefSeq) Fcf2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fcf2
Motif
Other DBs
NCBI-GeneID: 850740
NCBI-ProteinID: NP_013152
SGD: S000004041
UniProt: Q12035
Position
XII:complement(246324..246977)
Genome map
AA seq 217 aa AA seqDB search
MDQSVEDLFGALRDASASLEVKNSAKEQVSLQQEDVLQIGNNDDEVEIESKFQEIETNLK
KLPKLETGFDALANKKKKKNVLPSVETEDKRKPNKSDKNDNDWFTLPKPDDNMRREVQRD
LLLIKHRAALDPKRHYKKQRWEVPERFAIGTIIEDKSEFYSSRMNRKERKSTILETLMGD
EASNKYFKRKYNEIQEKSTSGRKAHYKKMKEMRKKRR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaagtgtggaagacttatttggagcactaagagatgctagtgccagtctagaa
gtaaaaaattcagcgaaggaacaagtttctcttcaacaagaggatgttttgcagataggc
aataatgatgatgaagtagaaattgaaagtaaatttcaagagatcgaaactaatcttaag
aagcttcctaagttagaaaccggatttgatgctttagcaaacaagaagaagaagaagaac
gtcttgcctagtgtggagacagaagataaaagaaaacccaacaagagcgacaaaaacgat
aatgactggtttaccttaccaaagccagatgataacatgcgtcgtgaagttcaacgagat
ttattgctgattaaacatagagctgctcttgatccaaagagacattataagaagcaacgt
tgggaggtgccagagaggtttgctattggtaccataattgaagacaagagtgagttttat
agtagtcgtatgaacaggaaggaaagaaagtcgactattttggaaacactcatgggtgat
gaagcttctaataagtatttcaagcgtaaatacaacgaaattcaggagaaatctacgagc
ggtaggaaggcacattacaagaaaatgaaagagatgagaaagaagcggaggtga

DBGET integrated database retrieval system