KEGG   Saccharomyces cerevisiae (budding yeast): YLR052WHelp
Entry
YLR052W           CDS       T00005                                 

Gene name
IES3
Definition
(RefSeq) Ies3p
  KO
K11677  Ino eighty subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR052W (IES3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   INO80 complex (yeast)
    YLR052W (IES3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 850741
NCBI-ProteinID: NP_013153
SGD: S000004042
UniProt: Q12345
Position
XII:247201..247953
Genome map
AA seq 250 aa AA seqDB search
MKFEDLLATNKQVQFAHAATQHYKSVKTPDFLEKDPHHKKFHNADGLNQQGSSTPSTATD
ANAASTASTHTNTTTFKRHIVAVDDISKMNYEMIKNSPGNVITNANQDEIDISTLKTRLY
KDNLYAMNDNFLQAVNDQIVTLNAAEQDQETEDPDLSDDEKIDILTKIQENLLEEYQKLS
QKERKWFILKELLLDANVELDLFSNRGRKASHPIAFGAVAIPTNVNANSLAFNRTKRRKI
NKNGLLENIL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgaagacctcttggcaaccaataaacaggtgcagtttgctcatgcagctact
caacattacaaaagtgtcaaaactccagatttcttggagaaagacccacatcacaaaaaa
tttcataacgcagatggcttgaatcaacaaggttcttcgaccccatctacagctaccgat
gcaaatgccgcctcaactgcttccactcacacaaacaccacgacattcaaaagacacatt
gttgccgtggatgacatatcgaaaatgaactatgaaatgataaagaattctccagggaat
gtaataacgaacgctaaccaagatgagatagatataagcaccctcaagacaaggttgtac
aaggacaatctttacgctatgaatgacaactttttacaagctgtcaatgaccaaattgta
acattaaatgcagcggagcaggaccaagaaactgaggaccctgacttatcagatgatgaa
aaaattgatatactgaccaaaatccaagagaacttgcttgaagagtaccaaaaactttca
cagaaagaaagaaagtggtttatattgaaagaactactgttggatgcaaatgtagaactc
gatttgttcagtaatcgtggcaggaaggcaagccatccaatcgcattcggagcagtagcc
ataccaacgaacgtcaatgcgaattcactagcatttaacagaaccaagagaagaaaaatt
aataagaacggccttttggaaaacattctttaa

DBGET integrated database retrieval system