KEGG   Saccharomyces cerevisiae (budding yeast): YLR055CHelp
Entry
YLR055C           CDS       T00005                                 

Gene name
SPT8
Definition
(RefSeq) SAGA complex subunit SPT8
  KO
K11360  transcriptional activator SPT8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YLR055C (SPT8)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR055C (SPT8)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YLR055C (SPT8)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     YLR055C (SPT8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 850744
NCBI-ProteinID: NP_013156
SGD: S000004045
UniProt: P38915
Position
XII:complement(251272..253080)
Genome map
AA seq 602 aa AA seqDB search
MDEVDDILINNQVVDDEEDDEEMLSGLENDSKQDLEGNDDGGEDEEDDDDDDEDDDDDED
EREDDDEQEDDDGEDDAARMDKTATPTNEHQHDEQKAAAAGAGGAGDSGDAVTKIGSEDV
KLSDVDGGVGSREASSSTHEASANGEVYEYYKHMLNAAQIADSYNIYPTAAIPIQTHVNA
LAVSRGLKYLFLGGSDGYIRKYDLLNTLEGKLSLTILQKHSLAESIQNAGILQSYWENEI
PQKKSEMKLSANKTDYEPKVSPVHSLEVQSECLFILSGLQNGGITMQGVRYMEGSIAHYF
KGRNGHTQIVNILRLNGQEDRFLSGSWDKRLLEWDLQTGDIVNEFKKSRSELSSLEMRPL
YSSVDVSGNVNSGKENENADDDMDSLFGDEDEDEKQDAGNEPVETGDGSNGEENKEQISE
ESLNIVYDESVFMTSGLNGSVHIWDRRMTQSPALSLERGAGVPPWCLSACWGVDGDHVYA
GRRNACVEQFDLKMPSKPIHNLKLPSISGPVSCVKAMPNNKHLLCASRDNIRLYNVEIAV
DASNSTTKSSKVPFLIVPGHHGGIISNLYLDPTSRFIISTSGNRGWQGNSTDTTLIYDID
LE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggttgacgatattctaattaacaaccaggtggtggatgacgaggaggatgac
gaagagatgctgagtgggctggaaaacgactcaaagcaggacctcgaggggaatgatgac
ggtggtgaagatgaagaggatgacgatgatgatgatgaggacgatgatgatgacgaggac
gaacgagaggacgacgatgaacaggaggacgacgatggtgaggacgacgccgcaagaatg
gataagactgctacaccgacgaatgagcaccagcatgatgagcaaaaggctgctgctgct
ggtgctggcggtgcaggcgatagtggcgatgctgttactaagattggatccgaggatgtg
aaattgagcgatgttgatggaggagtggggtccagggaagcatcttcctctacacacgaa
gcctctgctaatggagaggtttatgagtactataagcacatgttgaatgccgcacagatt
gcggattcgtacaatatctaccccacggcagccatacccatccagacgcacgtcaatgcg
ttggccgtgtccaggggtctcaagtacctgtttttgggcggtagcgatggatacataagg
aagtacgacttgctgaacacgcttgaggggaaactttctctaactatcctgcagaagcat
tcgttggctgagtctattcagaacgcgggtatcttgcagtcgtactgggaaaatgagatc
ccgcagaaaaaatcagaaatgaaactctccgctaataagacagattacgagcccaaagtt
agccccgttcattctttggaagtccaaagcgaatgcctctttatactgagcgggctacag
aatggtgggattaccatgcagggcgttcgctacatggaggggagcattgcgcactatttt
aagggcaggaatggacatacccaaatcgttaacatactgagattaaacggtcaagaggac
aggtttttgagtggttcctgggataagcgtcttttggaatgggatttgcagacgggtgac
atagttaatgagtttaaaaaatcaaggtctgaattgtcatctttggaaatgcggccgctg
tactcgtccgtggatgtgtccggtaacgtcaacagtggtaaagagaatgaaaatgcagat
gacgatatggattctctgtttggtgatgaagacgaagacgaaaagcaagatgctggcaac
gaacccgtcgagacgggggatggttctaatggtgaagagaacaaagaacagatatctgaa
gaatctttgaacatagtctatgatgaatccgtttttatgacctcagggttgaacggttcc
gtgcatatttgggaccgacgcatgacgcagtcgccagcattgtctctggagagaggtgca
ggcgtcccaccgtggtgtttgtccgcatgttggggtgtagatggtgatcatgtgtatgca
gggagaaggaatgcctgtgtggagcagtttgacttgaagatgccctcgaaacctatccat
aatttgaaactgccttctatttcagggcctgtctcttgtgttaaagccatgcctaataac
aagcatttactatgtgcatcgcgggataatatcagattgtacaacgttgaaattgcagta
gatgcttcgaattcgactacaaagagttctaaagtgccgttcctcatcgtgccgggccat
cacggtggtattatatcaaacttatacctcgaccccacttcaagatttataataagcaca
agtggcaacagaggctggcaggggaattctacggacacgacccttatttacgatatagac
ttagaatag

DBGET integrated database retrieval system