KEGG   Saccharomyces cerevisiae (budding yeast): YLR056WHelp
Entry
YLR056W           CDS       T00005                                 

Gene name
ERG3, PSO6, SYR1
Definition
(RefSeq) C-5 sterol desaturase
  KO
K00227  Delta7-sterol 5-desaturase [EC:1.14.19.20]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00100  Steroid biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Module
sce_M00102  Ergocalciferol biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    YLR056W (ERG3)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.20  Delta7-sterol 5(6)-desaturase
     YLR056W (ERG3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_hydroxylase CitMHS
Motif
Other DBs
NCBI-GeneID: 850745
NCBI-ProteinID: NP_013157
SGD: S000004046
UniProt: P32353
Position
XII:253861..254958
Genome map
AA seq 365 aa AA seqDB search
MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVK
ECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVF
DKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRK
LIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSI
SYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYG
QFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPN
TKKNN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtcttagaagtcgctgaccattatgtcttagacgacttgtacgctaaagtt
ctgcccgcttcgttggcagctaatattcctgtcaagtggcagaaattgctagggttgaac
agtgggttcagcaattctacgattttgcaggagactttgaactccaagaatgccgtcaaa
gaatgtagaaggttctacgggcaggtgccattcctgtttgatatgtcgacgacgtctttt
gcatcgctattgcctcgttccagcatcttgagagaattcctctcactatgggttattgtt
acgatctttggtttactactttacttattcacggctagtctcagctacgtgtttgtgttt
gacaagtcgattttcaaccatcctcgttacttgaaaaaccaaatggcaatggaaatcaag
ttggcagtcagtgctatcccatggatgtcgatgttgaccgttccatggtttgttatggaa
ttgaacggccattctaaactatacatgaagattgattatgaaaaccacggtgtaaggaag
ctcattatcgagtacttcactttcatctttttcactgattgcggtgtgtatttagcgcac
agatggttgcattggccaagggtctaccgtgctctgcacaagcctcatcacaagtggctg
gtctgcacacctttcgcatctcattctttccatcctgtagacgggtttttgcaatccatc
tcgtaccacatctacccattgattctgccattacacaaggtttcttatttgattctgttc
acttttgttaacttttggactgttatgattcatgacggtcaatacctatcaaacaatcct
gccgtcaacggtactgcctgccacacggttcaccatctatatttcaactacaactacggt
caattcaccactctgtgggacagactagggggttcttaccgtagaccagatgactcattg
tttgatcctaagttaagagatgctaaggagacctgggacgctcaagttaaggaagttgaa
catttcatcaaggaggtcgaaggtgatgataatgatagaatctatgaaaacgacccaaat
accaagaagaacaactga

DBGET integrated database retrieval system