KEGG   Saccharomyces cerevisiae (budding yeast): YLR057WHelp
Entry
YLR057W           CDS       T00005                                 

Gene name
MNL2
Definition
(RefSeq) putative mannosidase MNL2
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00073  N-glycan precursor trimming
sce_M00074  N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YLR057W (MNL2)
   00513 Various types of N-glycan biosynthesis
    YLR057W (MNL2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YLR057W (MNL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLR057W (MNL2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     YLR057W (MNL2)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    YLR057W (MNL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_47
Motif
Other DBs
NCBI-GeneID: 850746
NCBI-ProteinID: NP_013158
SGD: S000004047
UniProt: Q12205
Position
XII:255306..257855
Genome map
AA seq 849 aa AA seqDB search
MSIARLVYSLFRRVRSVLLLFITISLLFYYTFQNEIDILNSYALNDSLPSINNYEHNTEG
SSKLDPPDLSSTGSDRIATDKENGNVAVDLSDPATLREKNKYFPLLLKGSSHQIGSNLPI
SSLLTYKEKYPVLFEYSSPSLTSISQNDVHKIQPAMQLPPDVDMIKQIKDIFMKSWNQEQ
LLLKSNLRRESTWPIDLIDSLDTLYLCGETKLFQDSVNIIEDFDFRVPPLAMEVIDIPDI
TTRVLEGLLSAYELSMDKRLLNKAKHVADFILRSFDTPNRIPILKYFWKSDLRNRFPDRT
VPSGQLTTMALAFIRLSQLTRLNKYFDAVERVFTTIRQSYNEFDMEFMLPDVVDASGCQL
LTQEEIENGAHLKGSSIMKSINENFKFVHCQQLGKFLNPPIDDNSLQEQSQYQAYRINEK
TVPILENLFKINDLFQSSYDILDGSSKNANAATMDPSIGSEVEAVDEIIEKRNFKDGTKK
DSTKNTVGDKSLIDSQTFLTNSISNIFKFMTFRPMLPKQTENKKFNFLNSILTKSQFMPT
TNELDVTIRKSYDVSLYSCRLGGILGLSSRVPHRGGVNTKYILPSSLLEMSEIITESCFM
LMEEFDGLLPQKFELDPCTDETNGNCEFNGETKSRMIANGEYETFENDLDVGIKVSNYGK
GGNDQKAKRNVLSKDGITETQNIKGDTVGSSKSIAEIDGDEVTQIRRVFTLGKDIKPHIT
TDDTMGSQWKNHPDWPFWVNKVESRRLLDSNIIESIFYMYRISGEQKWRSMGKQSFGILM
QELMELNSGAKGLWQIKEFYENGEKVNNDLPSYWFSRTLKYYLLLFSDGDKVSLDKHILT
QGGHIIKKK
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagcgcgattagtatactctcttttcagaagagtacgatcggttctcttactt
ttcattaccatatcgctattgttttactatacgttccagaatgaaatcgatatcttgaat
tcgtacgctttaaacgactcactaccgtccataaacaactatgagcacaatacagaaggt
tcttcgaaactggatcctccagacctatcgtcaaccggttctgaccgaatagccaccgac
aaggaaaatggcaacgttgcagtggatttgtcagatccagctacattgagagaaaaaaac
aagtactttcccttgctgttaaagggatcgtctcaccagattggttcgaatttaccaatt
tcgtctcttttgacatataaggaaaagtatcccgtcttgttcgaatactcatcaccttcc
ttaacttctataagccagaatgacgttcataagatacagccggcaatgcaattgccacca
gatgttgatatgataaaacagataaaggacattttcatgaaatcatggaaccaagagcag
ttgctgctgaaaagtaacctcagaagggaatctacttggcccatagatctaattgattct
ctagatacattgtatctatgtggcgagacgaaactttttcaagattctgttaatataata
gaagattttgactttcgagtacctccgttagcaatggaagttattgatattcctgacatc
actacccgtgtcctagaagggttactgtctgcatacgaattatctatggataaacgatta
cttaacaaagcaaaacatgttgcagatttcatattaagatcatttgatacccctaataga
attcctattttgaaatatttttggaaatctgatctgagaaatcgatttccagaccgtact
gttccatcaggtcaattgactactatggcactcgcgtttatcagattgtcacagttaacc
cgtttgaataagtattttgatgctgttgaaagagttttcaccactatacgtcaatcatat
aacgaatttgatatggagtttatgctgcctgacgtcgttgatgcctctggttgccagtta
ttaactcaagaggaaattgagaatggtgcacacctaaagggatccagcatcatgaaaagt
atcaatgaaaatttcaagttcgtacactgtcagcagttagggaaattcttaaatcctcca
atagatgataatagcctccaagaacaatctcaataccaggcttatagaattaatgaaaaa
acagtacccattctagaaaatctattcaaaatcaatgacctcttccaatcttcttatgat
atcctggacggctcaagtaaaaatgctaatgctgcaacgatggaccccagtattggttca
gaggtagaagcagtcgacgaaataattgagaaaagaaactttaaagacggtactaaaaaa
gattcgacaaaaaacaccgtaggtgataaatcattaatagactcgcaaacgtttttaaca
aattccatcagtaacatttttaaattcatgacttttcgacccatgttgcccaagcaaacg
gaaaacaaaaagtttaattttctgaattccattctaacaaaatctcaattcatgcccacg
actaatgagctagatgtcacgataagaaaatcttacgatgtctcgttatactcatgcaga
cttggcggcattctaggtttaagttcacgtgttccccaccgaggcggtgtcaacacgaaa
tatattttaccatcgtcactattggaaatgagcgaaataataacagaaagttgttttatg
ctaatggaggagttcgacgggctgctccctcaaaaattcgagttggacccttgcactgat
gagactaatgggaattgcgagtttaacggcgaaactaaatcacgaatgattgccaacggc
gaatatgaaacttttgaaaatgacctagatgtcgggatcaaagtttcgaattatgggaaa
ggtgggaatgaccagaaagctaagagaaatgtactaagcaaagatgggataacagagact
caaaacataaaaggtgatactgttggaagctcgaaatcgattgctgaaatagacggcgac
gaagtaacgcaaatacgtagagtttttacgcttggtaaggatatcaaaccgcatattaca
acggacgataccatgggttctcagtggaaaaaccatccagactggccattttgggtcaac
aaggtagaatccagaagattgttggattcgaatatcattgaatctatattttatatgtac
agaatcagtggagaacaaaaatggagaagcatgggtaagcagtcttttggaatcttaatg
caagaattaatggaactaaacagtggtgccaaaggattgtggcaaataaaggaattttat
gaaaacggtgaaaaagtgaacaatgatttacctagctattggttctccagaacattaaaa
tactatttgctactattcagcgatggtgacaaggtttccctggacaaacacatcttaact
caaggagggcacataatcaaaaagaaatga

DBGET integrated database retrieval system