KEGG   Saccharomyces cerevisiae (budding yeast): YLR058CHelp
Entry
YLR058C           CDS       T00005                                 

Gene name
SHM2, SHMT2
Definition
(RefSeq) glycine hydroxymethyltransferase SHM2
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00260  Glycine, serine and threonine metabolism
sce00460  Cyanoamino acid metabolism
sce00630  Glyoxylate and dicarboxylate metabolism
sce00670  One carbon pool by folate
sce00680  Methane metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YLR058C (SHM2)
  09102 Energy metabolism
   00680 Methane metabolism
    YLR058C (SHM2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YLR058C (SHM2)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    YLR058C (SHM2)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    YLR058C (SHM2)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     YLR058C (SHM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Aminotran_5 Beta_elim_lyase HPD
Motif
Other DBs
NCBI-GeneID: 850747
NCBI-ProteinID: NP_013159
SGD: S000004048
UniProt: P37291
Position
XII:complement(257992..259401)
Genome map
AA seq 469 aa AA seqDB search
MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTSTSVFDALGTPL
SNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPDKWGVNVQTLSGSPANLQVYQ
AIMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKN
AILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYAD
IVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI
AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMVLVSLREKGVD
GARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMTTRGMGEEDFHRIVQYINKAV
EFAQQVQQSLPKDACRLKDFKAKVDEGSDVLNTWKKEIYDWAGEYPLAV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgccttacactctatccgacgctcatcataagttgatcacctctcatttggtggacacc
gaccctgaagtggactccattatcaaggatgaaattgaaagacaaaagcactccatcgat
ttgattgcttctgaaaatttcacctcaacctccgttttcgatgcccttggaactccattg
tccaacaaatactctgaaggttatccaggtgctcgttactacggtggtaatgaacacatt
gacagaatggaaattctatgtcaacaaagagctttgaaagctttccatgttactccagac
aaatggggtgttaacgtccaaactttatctggttctcctgctaacttgcaggtttatcaa
gctattatgaagcctcatgaaagattgatgggtctatacctaccagatggtggtcatttg
tctcacggttacgctactgaaaacagaaaaatttctgctgtttccacatacttcgaatct
ttcccatacagagttaacccagaaaccggtattatcgactacgatactttagaaaagaac
gccatcctatatagaccaaaggttcttgttgctggtacttcagcatactgtcgtttaatt
gactacaagagaatgagagaaatcgccgacaaatgtggtgcttacttgatggtagacatg
gcccacatttctggtttgatcgccgcaggtgtcatcccatctcctttcgaatacgctgat
atcgttaccaccaccactcacaagtctttgagaggtccacgtggtgctatgattttcttc
agaagaggtgtgagatctatcaaccctaagaccggtaaggaagttctatacgacttggaa
aacccaattaacttctctgttttcccaggtcaccaaggtggtccacacaaccataccatt
gctgctttggccactgctttgaagcaagctgccactccagaattcaaggaataccaaact
caagtcttgaagaatgctaaggctttggaaagtgaatttaagaacttgggctacagatta
gtttccaacggtaccgattctcacatggttctagtatccttgagagaaaagggtgttgat
ggtgctcgtgttgaatacatttgtgaaaagattaacattgctttgaacaaaaactctatt
ccaggtgacaaatctgctttggttccaggtggtgtccgtattggggctccagccatgacc
actagaggaatgggtgaagaagatttccacagaattgttcaatacattaacaaggctgta
gaattcgctcaacaagttcaacaaagcttgccaaaggatgcttgtagattaaaggacttc
aaagccaaggtcgacgaaggctctgatgttttgaacacctggaaaaaggaaatttacgac
tgggctggcgaatacccattggctgtgtaa

DBGET integrated database retrieval system