KEGG   Saccharomyces cerevisiae (budding yeast): YLR059CHelp
Entry
YLR059C           CDS       T00005                                 

Gene name
REX2, YNT20
Definition
(RefSeq) Rex2p
  KO
K13288  oligoribonuclease [EC:3.1.-.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YLR059C (REX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YLR059C (REX2)
   03009 Ribosome biogenesis [BR:sce03009]
    YLR059C (REX2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     YLR059C (REX2)
Messenger RNA biogenesis [BR:sce03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     YLR059C (REX2)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    YLR059C (REX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T
Motif
Other DBs
NCBI-GeneID: 850748
NCBI-ProteinID: NP_013160
SGD: S000004049
UniProt: P54964
Position
XII:complement(259738..260547)
Genome map
AA seq 269 aa AA seqDB search
MKWLLFPARIVARTRPNLFSLYRRSVSQYLRPRTIQNLQSMAQTPELKTKLFKPLVWIDC
EMTGLDHVNDRIIEICCIITDGHLAPVKAADGQGDSHYESVIHYGPEVMNKMNEWCIEHH
GNSGLTAKVLASEKTLAQVEDELLEYIQRYIPDKNVGVLAGNSVHMDRLFMVREFPKVID
HLFYRIVDVSSIMEVARRHNPALQARNPKKEAAHTAYSDIKESIAQLQWYMDNYLKPPQE
TESVESIGSEQPESPSSSTSSLKRQRTDF
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgttgtttccggcaagaatcgtagctcgcactcgcccaaacctcttctcg
ctgtacagaagatccgtttcacagtacttacgtcctcgaaccatccaaaacctgcaatca
atggcgcaaacacccgaacttaaaaccaagctgttcaaacccttggtctggatcgactgc
gagatgaccggtttagaccacgtgaatgacagaattatcgagatttgctgcatcatcacc
gatggacacctggcacccgtcaaagcggccgatggccaaggagactcgcattatgagagc
gtcatccattatggtcccgaggtgatgaacaaaatgaacgagtggtgtattgagcaccac
ggtaatagcggtctcaccgccaaagttttggcaagtgagaagactttggcccaggtagaa
gatgagctgctcgagtacatccagcgctacatcccagacaagaacgttggcgtcttggca
ggcaatagtgtacatatggaccgcttgttcatggtccgcgagtttcccaaggtcattgat
catctcttttacagaatagttgacgtcagtagcatcatggaagttgcccgcagacacaat
cccgctttacaagcacgtaatccaaaaaaagaagctgcccacactgcttatagtgatatc
aaagagagcatagctcaattgcaatggtacatggacaactacttgaagccaccacaggaa
acagagtcggtcgagtcaatcggatctgaacagccggagtcaccatcttcatctacctca
tctttgaaaagacaacgcaccgatttttaa

DBGET integrated database retrieval system