KEGG   Saccharomyces cerevisiae (budding yeast): YLR078CHelp
Entry
YLR078C           CDS       T00005                                 

Gene name
BOS1, SEC32
Definition
(RefSeq) Bos1p
  KO
K08496  golgi SNAP receptor complex member 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    YLR078C (BOS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLR078C (BOS1)
Membrane trafficking [BR:sce04131]
 SNARE
  SNAP-25[N] (Qb)
   Bos1 / Membrin
    YLR078C (BOS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: V-SNARE_C Sec20 HSD3 Allexi_40kDa TMPIT Tup_N
Motif
Other DBs
NCBI-GeneID: 850767
NCBI-ProteinID: NP_013179
SGD: S000004068
UniProt: P25385
Position
XII:complement(join(285736..286467,286557..286559))
Genome map
AA seq 244 aa AA seqDB search
MNALYNHAVKQKNQLQQELARFEKNSVTAPISLQGSISATLVSLEKTVKQYAEHLNRYKE
DTNAEEIDPKFANRLATLTQDLHDFTAKFKDLKQSYNENNSRTQLFGSGASHVMDSDNPF
STSETIMNKRNVGGASANGKEGSSNGGGLPLYQGLQKEQSVFERGNAQLDYILEMGQQSF
ENIVEQNKILSKVQDRMSNGLRTLGVSEQTITSINKRVFKDKLVFWIALILLIIGIYYVL
KWLR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctttacaaccatgctgtgaagcaaaaaaatcaactacaacaagagttggcc
aggtttgaaaagaattctgtgaccgcccctatttctttacaagggtccatctctgcaact
ctggtctcactggagaaaacagttaagcaatatgcagaacatttaaacagatataaagaa
gatactaatgcagaggaaattgatcctaagttcgctaatcgactagcaactttaacacag
gatctgcacgactttactgccaagtttaaggatttaaaacaatcctacaacgaaaataat
tccagaactcagttgtttggctcaggagcatcgcatgttatggactccgataaccccttt
agtacatcagagaccatcatgaataaaaggaacgttggtggtgcgagtgcaaatggtaaa
gagggctctagcaacggtgggggactaccgttgtaccaagggctacaaaaggaacagtct
gttttcgaaaggggtaacgctcaattagattacattctagaaatgggccaacaatcattc
gaaaatatagtggaacaaaacaaaattttatccaaggtacaagatagaatgtcaaatggc
ctaagaacattgggtgtttcggaacaaactatcacctctatcaataaacgggtgttcaaa
gataaactagtcttttggatcgcgttaattctcttgatcataggtatttattatgtgttg
aaatggttaagatag

DBGET integrated database retrieval system