KEGG   Saccharomyces cerevisiae (budding yeast): YLR100WHelp
Entry
YLR100W           CDS       T00005                                 

Gene name
ERG27
Definition
(RefSeq) 3-keto-steroid reductase
  KO
K09827  3-keto steroid reductase [EC:1.1.1.270]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00100  Steroid biosynthesis
sce01100  Metabolic pathways
sce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    YLR100W (ERG27)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.270  3beta-hydroxysteroid 3-dehydrogenase
     YLR100W (ERG27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short Peptidase_C47
Motif
Other DBs
NCBI-GeneID: 850790
NCBI-ProteinID: NP_013201
SGD: S000004090
UniProt: Q12452
Position
XII:341810..342853
Genome map
AA seq 347 aa AA seqDB search
MNRKVAIVTGTNSNLGLNIVFRLIETEDTNVRLTIVVTSRTLPRVQEVINQIKDFYNKSG
RVEDLEIDFDYLLVDFTNMVSVLNAYYDINKKYRAINYLFVNAAQGIFDGIDWIGAVKEV
FTNPLEAVTNPTYKIQLVGVKSKDDMGLIFQANVFGPYYFISKILPQLTRGKAYIVWISS
IMSDPKYLSLNDIELLKTNASYEGSKRLVDLLHLATYKDLKKLGINQYVVQPGIFTSHSF
SEYLNFFTYFGMLCLFYLARLLGSPWHNIDGYKAANAPVYVTRLANPNFEKQDVKYGSAT
SRDGMPYIKTQEIDPTGMSDVFAYIQKKKLEWDEKLKDQIVETRTPI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggaaagtagctatcgtaacgggtactaatagtaatcttggtctgaacattgtg
ttccgtctgattgaaactgaggacaccaatgtcagattgaccattgtggtgacttctaga
acgcttcctcgagtgcaggaggtgattaaccagattaaagatttttacaacaaatcaggc
cgtgtagaggatttggaaatagactttgattatctgttggtggacttcaccaacatggtg
agtgtcttgaacgcatattacgacatcaacaaaaagtacagggcgataaactaccttttc
gtgaatgctgcgcaaggtatctttgacggtatagattggatcggagcggtcaaggaggtt
ttcaccaatccattggaggcagtgacaaatccgacatacaagatacaactggtgggcgtc
aagtctaaagatgacatggggcttattttccaggccaatgtgtttggtccgtactacttt
atcagtaaaattctgcctcaattgaccaggggaaaggcttatattgtttggatttcgagt
attatgtccgatcctaagtatctttcgttgaacgatattgaactactaaagacaaatgcc
tcttatgagggctccaagcgtttagttgatttactgcatttggccacctacaaagacttg
aaaaagctgggcataaatcagtatgtagttcaaccgggcatatttacaagccattccttc
tccgaatatttgaattttttcacctatttcggcatgctatgcttgttctatttggccagg
ctgttggggtctccatggcacaatattgatggttataaagctgccaatgccccagtatac
gtaactagattggccaatccaaactttgagaaacaagacgtaaaatacggttctgctacc
tctagggatggtatgccatatatcaagacgcaggaaatagaccctactggaatgtctgat
gtcttcgcttatatacagaagaagaaactggaatgggacgagaaactgaaagatcaaatt
gttgaaactagaacccccatttaa

DBGET integrated database retrieval system