KEGG   Saccharomyces cerevisiae (budding yeast): YLR104WHelp
Entry
YLR104W           CDS       T00005                                 

Gene name
LCL2
Definition
(RefSeq) Lcl2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUIM_assoc DUF2633
Motif
Other DBs
NCBI-GeneID: 850794
NCBI-ProteinID: NP_013205
SGD: S000004094
UniProt: Q08045
Position
XII:346585..346980
Genome map
AA seq 131 aa AA seqDB search
MSQSRWSIVLIFALFIFGSTGVNAFFNFGHHQQQQQQQQQSYEDQVLNNPCDGYLCPDTL
TCVAQQKDCPCPFPKSQLKCVLPDNKFVCISKPATHNEKFRAIYDDPVKGPKAKNKGFRD
CGWVSDAYKNH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaagtcgctggagtatcgttctcatctttgcattgtttatttttggcagcact
ggagtgaatgccttcttcaatttcggtcatcatcagcaacagcaacagcaacagcaacaa
tcatatgaagatcaagttttaaataacccttgtgatgggtatttgtgtccggacacccta
acgtgcgttgcacagcagaaagactgtccttgtcccttccctaaatctcagttgaaatgt
gtccttcctgataataaatttgtttgcatatccaaaccagccacacacaatgaaaagttt
agagcaatatatgatgaccctgtcaagggccccaaagcaaagaacaaggggtttagggat
tgtggatgggtatcagatgcttacaaaaaccattga

DBGET integrated database retrieval system