KEGG   Saccharomyces cerevisiae (budding yeast): YLR105CHelp
Entry
YLR105C           CDS       T00005                                 

Gene name
SEN2
Definition
(RefSeq) tRNA splicing endonuclease subunit SEN2
  KO
K15322  tRNA-splicing endonuclease subunit Sen2 [EC:4.6.1.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YLR105C (SEN2)
Enzymes [BR:sce01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.16  tRNA-intron lyase
     YLR105C (SEN2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing endonucleases
    YLR105C (SEN2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_int_endo
Motif
Other DBs
NCBI-GeneID: 850795
NCBI-ProteinID: NP_013206
SGD: S000004095
UniProt: P16658
Position
XII:complement(347047..348180)
Genome map
AA seq 377 aa AA seqDB search
MSKGRVNQKRYKYPLPIHPVDDLPELILHNPLSWLYWAYRYYKSTNALNDKVHVDFIGDT
TLHITVQDDKQMLYLWNNGFFGTGQFSRSEPTWKARTEARLGLNDTPLHNRGGTKSNTET
EMTLEKVTQQRRLQRLEFKKERAKLERELLELRKKGGHIDEENILLEKQRESLRKFKLKQ
TEDVGIVAQQQDISESNLRDEDNNLLDENGDLLPLESLELMPVEAMFLTFALPVLDISPA
CLAGKLFQFDAKYKDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGPPFQHAEF
CVMGLDHDVSKDYTWYSSIARVVGGAKKTFVLCYVERLISEQEAIALWKSNNFTKLFNSF
QVGEVLYKRWVPGRNRD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagggagggtcaatcagaagcgttacaagtatcctcttccaattcaccccgta
gatgaccttccagagttaatccttcataatccgttatcttggctatattgggcataccgc
tattacaagagtacgaacgcactgaacgataaagtacatgtagattttataggagatacc
actcttcacatcacggttcaagatgacaagcaaatgctatatctttggaataatggattt
tttggcactggtcaatttagcaggagtgagcctacatggaaagctagaacagaggccaga
ctgggtctcaatgatactcccctccacaatcggggaggaacaaagagtaatactgaaacg
gagatgactttagagaaggtcacacaacagaggagattacaaagattagagttcaagaaa
gaacgtgcgaagttagaaagagaattactagaattaagaaaaaaaggtggtcatatcgat
gaggaaaacatcctccttgagaaacaacgagaatcattaagaaaatttaaactaaaacaa
acagaagacgtgggcatcgttgcacaacagcaagacatttccgaatcaaatttaagagat
gaagacaacaatcttcttgatgagaacggtgatcttttgccactagagtcactagaacta
atgccagtggaagctatgtttttaacttttgcacttcctgttcttgacatatctcccgcg
tgcctggcagggaaactgtttcaattcgatgccaaatataaagatattcactcctttgtc
agatcatacgttatataccatcactacagatcacacggttggtgcgtaagatctggtata
aaattcggctgcgattatttattatataagagagggccaccatttcaacacgctgaattt
tgtgttatgggtcttgaccacgacgtctctaaagattatacgtggtattctagcatagcc
cgtgttgtgggcggcgcaaagaagacgtttgtgttatgctacgtggagagactaatctcg
gaacaggaggcgatagcactatggaaatcaaacaactttactaaattgttcaatagtttt
caagttggtgaagtattgtataagagatgggttcccggaagaaatagagactag

DBGET integrated database retrieval system