KEGG   Saccharomyces cerevisiae (budding yeast): YLR113W
Entry
YLR113W           CDS       T00005                                 

Symbol
HOG1, SSK3
Name
(RefSeq) mitogen-activated protein kinase HOG1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR113W (HOG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    YLR113W (HOG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YLR113W (HOG1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YLR113W (HOG1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   YLR113W (HOG1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase Kdo ABC1 APH TCAD9 FTA2 RIO1 Kinase-like
Other DBs
NCBI-GeneID: 850803
NCBI-ProteinID: NP_013214
SGD: S000004103
UniProt: P32485
Position
XII:371620..372927
AA seq 435 aa
MTTNEEFIRTQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDV
INTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHP
YSAPYHDPTDEPVADAKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGSDGQIDISATFD
DQVAAATAAAAQAQAQAQAQVQLNMAAHSHNGAGTTGNDHSDIAGGNKVSDHVAANDTIT
DYGNQAIQYANEFQQ
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaccactaacgaggaattcattaggacacagatattcggtacagttttcgagatcaca
aatagatacaatgatttaaaccccgttgggatgggggcatttgggttggtttgctcagcc
acggacactttgacatctcagccagttgccattaagaaaatcatgaaacctttttccact
gcagtgctggccaaaaggacatatcgtgaactaaaactactaaaacatctaagacacgag
aacttgatttgccttcaggacatatttctttctccattggaagatatatattttgtcacg
gaattacaaggaacagatttacatagactcttgcaaacaagacccttggaaaagcaattt
gttcagtatttcctataccaaattctaaggggtttaaaatacgttcactccgcgggcgtc
attcatagagatttgaaaccgagcaacattctgattaatgaaaactgtgatttgaagatt
tgcgatttcggtctagcaagaattcaagaccctcaaatgacaggctatgtttccactaga
tactacagggcacctgaaatcatgctaacgtggcaaaaatatgacgtcgaggtcgacatt
tggtccgctggttgtatttttgccgaaatgattgaaggtaagcctttgttccctgggaaa
gatcatgttcaccaattttcgatcatcactgacttgttgggatctccgccaaaggatgtg
ataaatactatttgttccgaaaatactctaaaatttgttacttcgttaccacacagagat
ccaattccattttctgaaagatttaaaacagtcgaacctgatgccgtagaccttttggaa
aaaatgctggtttttgatcctaagaagagaatcactgcggcggatgccttggctcatcct
tattcggctccttaccacgatccaacggatgaaccagtagccgatgccaagttcgattgg
cactttaatgacgctgatctgcctgtcgatacctggcgtgttatgatgtactcagaaatc
ctagacttccataagattggtggcagtgatggacagattgatatatctgccacgtttgat
gaccaagttgctgcagccaccgctgccgcggcgcaggcacaggctcaggctcaggctcaa
gttcagttaaacatggctgcgcattcgcataatggcgctggcactactggaaatgatcac
tcagatatagctggtggaaacaaagtcagcgatcatgtagctgcaaatgacaccattacg
gactacggtaaccaggccatacagtacgctaatgagttccaacagtaa

DBGET integrated database retrieval system