KEGG   Saccharomyces cerevisiae (budding yeast): YLR165C
Entry
YLR165C           CDS       T00005                                 
Symbol
PUS5
Name
(RefSeq) pseudouridine synthase PUS5
  KO
K15265  21S rRNA pseudouridine2819 synthase [EC:5.4.99.43]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YLR165C (PUS5)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.43  21S rRNA pseudouridine2819 synthase
     YLR165C (PUS5)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   YLR165C (PUS5)
SSDB
Motif
Pfam: PseudoU_synth_2 STATa_Ig
Other DBs
NCBI-GeneID: 850862
NCBI-ProteinID: NP_013266
SGD: S000004155
UniProt: Q06244
Position
XII:complement(494494..495258)
AA seq 254 aa
MSLKKQIPIIFENTHYFIVNKPPGIPSQPPDCRTWGRTHPNLDPTPLLERFKAIYYSHRE
VELCRTVHRLDHCVTGGMLIAKTKDGSVKFSRFLQKGGNNGYKLQRKYVAIVESSGRFNK
PNNYEIKYGPKYNFLISHGGREITKFKEVDENCIVLQLVTGKKHQIRNHVSQILNQPILN
DKRHGSTVNFPELFNDQIALHSACIITKIGLQTKTHLIPMEHNNTGQLWSRKYVNEEGEF
TLPIKEVLLENWDQ
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtctctgaaaaagcagataccaataatctttgaaaacacgcattacttcatagttaat
aaaccacctggcataccttctcaaccaccagactgcagaacatggggcaggacacatcct
aatcttgaccctactccactactagaaagattcaaggctatttattattcacatagagaa
gtagaattatgtcgtactgtacataggttagaccattgtgttacgggggggatgctgatt
gcaaagactaaagacggaagtgtaaaattctctagatttttacaaaagggcggcaacaac
ggttataagttgcaaagaaagtatgtagctattgtcgagtcgtccggtcgtttcaacaaa
ccaaataactatgaaattaaatatggtcctaaatataatttcttgatttcacatggtggt
agggagattactaagttcaaagaagttgacgaaaattgtattgttttacaattggttaca
ggaaaaaaacatcagattcgaaatcacgtctctcaaattttaaatcagcccatattaaac
gacaagagacatggcagcactgtcaattttccagagttgttcaatgaccaaatagcgttg
cattcagcgtgcataataacgaaaattggcctgcaaactaaaacgcacttgatacctatg
gaacacaataatactggccaactttggtcaagaaaatacgtcaatgaagagggtgagttc
actttgcccataaaagaagtcctgttggaaaactgggaccagtaa

DBGET integrated database retrieval system