KEGG   Saccharomyces cerevisiae (budding yeast): YLR170C
Entry
YLR170C           CDS       T00005                                 

Gene name
APS1, YAP19
Definition
(RefSeq) Aps1p
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLR170C (APS1)
Membrane trafficking [BR:sce04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    YLR170C (APS1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 850868
NCBI-ProteinID: NP_013271
SGD: S000004160
UniProt: P35181
Position
XII:complement(500579..501049)
AA seq 156 aa
MTQLKYLLLVSRQGKIRLKKWYTAMSAGEKAKIVKDLTPTILARKPKMCNIIEYNDHKVV
YKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNEM
IMCDGSIAESSRKEVLHHVTVMDTMESNDNLERVLS
NT seq 471 nt   +upstreamnt  +downstreamnt
atgacgcaattaaaatatttgttgctggtttctaggcaaggaaaaatcagattaaagaaa
tggtacacggcaatgtccgctggtgaaaaggcaaaaattgtgaaagacttgacacctacg
atattagcaagaaaacccaaaatgtgtaacatcatcgagtataatgaccacaaagtagta
tacaagcgatatgctagtctatattttattgttgggatgacgcccgatgttgacaatgaa
ctgctgaccttggaaattatccatcggtttgtcgaaacaatggacacatatttcggcaat
gtttgtgagctagacattatatttaacttcagtaaggtctacgatatcttgaatgagatg
attatgtgcgatggctccatcgcagagagcagtaggaaggaagtactgcaccatgtgacc
gtgatggacaccatggagagcaacgataatcttgaaagggtattgagttag

DBGET integrated database retrieval system