KEGG   Saccharomyces cerevisiae (budding yeast): YLR178CHelp
Entry
YLR178C           CDS       T00005                                 

Gene name
TFS1, DKA1
Definition
(RefSeq) Tfs1p
  KO
K06910  uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    YLR178C (TFS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP
Motif
Other DBs
NCBI-GeneID: 850875
NCBI-ProteinID: NP_013279
SGD: S000004168
UniProt: P14306
Structure
PDB: 

Position
XII:complement(513162..513821)
Genome map
AA seq 219 aa AA seqDB search
MNQAIDFAQASIDSYKKHGILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSK
PQFQFTFNKQMQKSVPQANAYVPQDDDLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLL
NEATHETSGATEFFASEFNTKGSNTLIEYMGPAPPKGSGPHRYVFLLYKQPKGVDSSKFS
KIKDRPNWGYGTPATGVGKWAKENNLQLVASNFFYAETK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagcaatagacttcgcacaagcaagcattgactcctacaagaagcacggcatt
ctggaggatgtaattcatgacacaagctttcaaccctccgggatacttgccgtagagtac
tcatcaagtgcacctgttgccatgggtaacacgctgcccactgagaaggcacgttccaag
ccccaattccagttcacgttcaataagcaaatgcaaaaaagcgtaccacaggcgaatgcg
tacgttccccaagacgacgatttgttcacactggtaatgaccgatccggatgctccctct
aagacagatcacaagtggtctgaattctgccacttggtagaatgcgacttaaagctgttg
aatgaggctactcacgagacctccggagcaaccgaattttttgcatcagagttcaatacg
aagggctcgaacacactaatagaatatatgggaccagctccacccaagggatccggtccc
cacagatatgttttcttgttatataagcagcctaagggcgtggactcatctaagttctcg
aaaattaaggatagaccgaactggggttacggcacccctgccaccggtgttggcaaatgg
gctaaggaaaacaacctgcaactagttgcctccaatttcttctatgcggaaacgaaatag

DBGET integrated database retrieval system