KEGG   Saccharomyces cerevisiae (budding yeast): YLR180WHelp
Entry
YLR180W           CDS       T00005                                 

Gene name
SAM1, ETH10
Definition
(RefSeq) methionine adenosyltransferase SAM1
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00270  Cysteine and methionine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01230  Biosynthesis of amino acids
Module
sce_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YLR180W (SAM1)
Enzymes [BR:sce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     YLR180W (SAM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_N S-AdoMet_synt_M AdoMet_Synthase
Motif
Other DBs
NCBI-GeneID: 850877
NCBI-ProteinID: NP_013281
SGD: S000004170
UniProt: P10659
Position
XII:515262..516410
Genome map
AA seq 382 aa AA seqDB search
MAGTFLFTSESVGEGHPDKICDQVSDAILDACLAEDPHSKVACETAAKTGMIMVFGEITT
KAQLDYQKIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGVHEEKDLEDIGAG
DQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLAWLRPDTKTQVTVEYKDDHG
RWVPQRIDTVVVSAQHADEITTEDLRAQLKSEIIEKVIPRDMLDENTKYFIQPSGRFVIG
GPQGDAGLTGRKIIVDAYGGASSVGGGAFSGKDYSKVDRSAAYAARWVAKSLVAAGLCKR
VQVQFSYAIGIAEPLSLHVDTYGTATKSDEEIIDIISKNFDLRPGVLVKELDLARPIYLP
TASYGHFTNQEYPWEKPKTLKF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggccggtacatttttattcacttctgaatccgttggtgaaggtcacccagataagatc
tgtgaccaagtttccgacgccatcttggacgcttgtttagccgaggaccctcactccaaa
gttgcgtgtgaaaccgcggcaaagactggtatgattatggtctttggtgaaattactacc
aaggcacagttggattaccaaaaaatcgtcagagacaccatcaagaagattggttacgat
gattccgccaagggtttcgactataagacctgtaacgtccttgtcgccattgagcaacaa
tctccagatatcgcccaaggtgtccacgaggagaaggatttggaagacatcggtgccggt
gaccaaggtatcatgtttggttacgccacagatgaaactccagagggtttgcctttgact
attcttttggctcataaactaaacatggccatggctgacgcgagaagagatggctcttta
gcgtggttgagaccagacaccaagactcaagtcaccgtcgaatacaaggatgaccacggt
agatgggttccacaaagaatcgacaccgtcgtcgtctccgctcaacatgctgacgaaatc
acgaccgaggacttaagagcgcaactaaagtccgagatcattgaaaaagtcatcccaaga
gacatgttggacgaaaacaccaaatactttatccaaccttccggtagattcgtcatcggt
ggtcctcaaggtgacgctggtttgaccggtagaaagatcatcgtcgacgcttacggtggt
gcctcatccgtcggtggtggtgccttctccggtaaggactactctaaggttgatcgttct
gccgcttatgccgctagatgggttgccaagtccctagttgccgctggtttatgtaagaga
gttcaagttcaattttcttatgccatcggtattgcggaaccattgtccttgcacgttgac
acctatggtactgcgaccaagtctgacgaagaaattatcgacattatcagcaagaacttt
gacttgagacctggtgtattggtcaaggagttggacttagctagaccaatctacttgcca
accgcttcttatggccatttcacaaaccaagaatacccatgggaaaagcctaagactttg
aagttctaa

DBGET integrated database retrieval system