KEGG   Saccharomyces cerevisiae (budding yeast): YLR182WHelp
Entry
YLR182W           CDS       T00005                                 

Gene name
SWI6, PSL8, SDS11
Definition
(RefSeq) transcriptional regulator SWI6
  KO
K06648  regulatory protein SWI6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR182W (SWI6)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR182W (SWI6)
   04113 Meiosis - yeast
    YLR182W (SWI6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YLR182W (SWI6)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   ZIP only
    YLR182W (SWI6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Swi6_N Ank_2 Ank_5 Ank_3 Ank Ank_4 Phage_GPO TPR_MLP1_2 FAP206 DUF3375 DUF3287 PcfJ COG5 Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 850879
NCBI-ProteinID: NP_013283
SGD: S000004172
UniProt: P09959
Structure
PDB: 

Position
XII:517940..520351
Genome map
AA seq 803 aa AA seqDB search
MALEEVVRYLGPHNEIPLTLTRDSETGHFLLKHFLPILQQYHDTGNINETNPDSFPTDEE
RNKLLAHYGIAVNTDDRGELWIELEKCLQLLNMLNLFGLFQDAFEFEEPETDQDEEDPSH
SKLPENKTKSENSKDNISSKRINNLQDMSLDSDAHRELGSPLKKLKIDTSVIDAESDSTP
NTARGKPNDDINKGPSGDNENNGTDDNDRTAGPIITFTHDLTSDFLSSPLKIMKALPSPV
VNDNEQKMKLEAFLQRLLFPEIQEMPTSLNNDSSNRNSEGGSSNQQQQHVSFDSLLQEVN
DAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVK
SVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIV
KKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQDSNGDTCLNIAARL
GNISIVDALLDYGADPFIANKSGLRPVDFGAGTSKLQNTNGGDENSKMVSKGDYDGQKNG
KAKKIRSQLLKNPPETTSLINDVQNLLNSISKDYENETVQYNEKLEKLHKELNEQREELA
NSREQLANVKQLKDEYSLMQEQLTNLKAGIEEEEESFREESKKLGIIADESSGIDWDSSE
YDADEPFKVEFLSDFLEDKLQKNYEGDISKLLEAESKEQIMEQIRNQLPAEKIQSMLPPT
VLLKARINAYKRNDKHLTNVLDTISTKQSELENKFRRVLSLCLKIDENKVDNMLDGLLQA
ISSEDPQDIDTDEMQDFLKKHAS
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggaagaagtggtacgatacttaggacctcacaatgagatccctttgacactc
actagagactcggagactggccatttcctcctgaaacattttctgcccattttgcagcaa
tatcatgacacggggaatattaacgagaccaaccccgatagtttccccactgatgaggaa
agaaataaattactggcacattatggaattgctgtaaatacagacgaccgaggtgagtta
tggatagagctggaaaaatgtttacaattattaaacatgctaaatttattcggtttgttc
caggatgcattcgaatttgaggagcctgaaacagatcaggatgaagaagatcccagccat
tcgaaactaccagaaaacaagaccaaaagtgaaaattctaaggataatatcagctcaaag
aggattaataatttacaagatatgagcctggattctgatgcacacagagaattaggctct
cctttaaaaaaactaaaaatagatacctctgtaatagatgctgagagtgactccactccg
aatactgccagaggcaagcctaacgatgatattaataagggccctagcggcgacaatgaa
aataatggcactgatgacaatgacagaaccgctggacctatcataacattcactcatgac
ctaacttctgactttttaagcagtccactgaaaatcatgaaagcactaccttctccagtt
gtaaatgataatgaacagaagatgaaactagaggcattcttacaacggttgttatttcca
gaaattcaagaaatgcctacatcccttaataatgacagcagtaatagaaattcagaaggg
gggagctcaaaccaacaacaacagcacgtatcatttgatagccttttgcaagaggtaaac
gacgcttttcctaatactcaattaaatcttaatattcctgtagatgagcatggaaacaca
ccattacattggctgacttcaatagcaaacctggaattagtgaaacacctggttaagcat
ggttcaaacagattatatggtgataatatgggggagtcatgcctagtgaaagctgtcaaa
tcagtaaataattacgactctggtacttttgaggcacttctagattatttatatccatgt
ttaattttggaagactcaatgaatagaacaattttgcaccatatcattattacgtctggt
atgactggctgttcagcagctgcgaaatattatttagatattttaatgggatggattgtc
aagaaacaaaatagacccattcaaagtggtactaacgaaaaagaaagcaaaccgaatgac
aaaaatggggaaagaaaggactctatactagaaaatttggacctgaaatggataatagca
aacatgctcaatgcgcaggactctaatggcgatacttgcttgaacattgcagcaagattg
ggaaacatttcaatagtagacgctttattagattacggtgctgacccatttattgcaaac
aaatcagggttgagacccgtggattttggggcaggtacttcaaaattacaaaatacgaac
ggcggtgacgaaaactcgaagatggtctctaagggtgattacgacggtcaaaaaaatgga
aaggccaaaaaaataaggtctcaactgttgaaaaacccacctgaaacaacttcgttaatt
aatgatgtccaaaatttactgaattcaatctcgaaagattatgagaatgaaacagtgcaa
tataatgagaaattagaaaaactacacaaggaattgaacgaacagcgagaagaattagct
aattctagagaacaactagcaaatgtgaagcaattgaaagatgaatactcactaatgcaa
gagcaattgaccaatttaaaagcaggaattgaagaagaagaggaaagttttagggaagag
agcaaaaagctaggaataattgcagatgaaagttcaggtattgattgggactctagcgaa
tatgatgcagatgaacccttcaaagtagagttcctttcagatttcttggaggataaatta
caaaagaattatgaaggcgatatttccaaactattagaagcggagtcgaaagagcagata
atggaacagatacgaaatcaacttcccgcagaaaaaatccaatcgatgcttccaccaacg
gtcttattgaaggcaagaataaatgcatacaagcggaatgataaacacctaaccaatgta
ttggatacaatcagcaccaaacaatcagaattagagaataaatttagaagagtgttatct
ttatgtttgaaaatcgacgaaaataaagttgacaatatgcttgatggtttgttacaggcc
atatcttctgaagacccacaagacattgacactgacgaaatgcaagattttttaaaaaag
catgcttcatga

DBGET integrated database retrieval system