KEGG   Saccharomyces cerevisiae (budding yeast): YLR185WHelp
Entry
YLR185W           CDS       T00005                                 

Gene name
RPL37A
Definition
(RefSeq) ribosomal 60S subunit protein L37A
  KO
K02922  large subunit ribosomal protein L37e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YLR185W (RPL37A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YLR185W (RPL37A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YLR185W (RPL37A)
  Archaea
    YLR185W (RPL37A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L37e DZR SelR DUF1258
Motif
Other DBs
NCBI-GeneID: 850882
NCBI-ProteinID: NP_013286
SGD: S000004175
UniProt: P49166
Structure
PDB: 

Position
XII:join(522663..522669,523029..523288)
Genome map
AA seq 88 aa AA seqDB search
MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTG
TGRMRYLKHVSRRFKNGFQTGSASKASA
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagggtactccttcattcggtaaacgtcacaacaagtcccacactttgtgtaac
agatgtggtcgtcgttctttccatgttcaaaagaagacctgttcctcctgtggttatcca
gctgctaagaccagatcttacaactggggtgccaaggctaagagaagacacactactggt
actggtagaatgagatacttgaaacacgtttcaagaagattcaagaacggtttccaaacc
ggctctgcttctaaggcttctgcttaa

DBGET integrated database retrieval system