KEGG   Saccharomyces cerevisiae (budding yeast): YLR186WHelp
Entry
YLR186W           CDS       T00005                                 

Gene name
EMG1, NEP1
Definition
(RefSeq) 18S rRNA pseudouridine methyltransferase
  KO
K14568  rRNA small subunit pseudouridine methyltransferase Nep1 [EC:2.1.1.260]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YLR186W (EMG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YLR186W (EMG1)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.260  rRNA small subunit pseudouridine methyltransferase Nep1
     YLR186W (EMG1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    YLR186W (EMG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EMG1
Motif
Other DBs
NCBI-GeneID: 850883
NCBI-ProteinID: NP_013287
SGD: S000004176
UniProt: Q06287
Structure
PDB: 

Position
XII:523632..524390
Genome map
AA seq 252 aa AA seqDB search
MVEDSRVRDALKGGDQKALPASLVPQAPPVLTSKDKITKRMIVVLAMASLETHKISSNGP
GGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDSPINKAGKLQVYIQTSRGI
LIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLLKVIKNPITDHLPTKCRKVTL
SFDAPVIRVQDYIEKLDDDESICVFVGAMARGKDNFADEYVDEKVGLSNYPLSASVACSK
FCHGAEDAWNIL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagattccagagttagagacgccctcaaaggtggtgatcagaaggcattaccg
gcctctttggttcctcaagcacctcctgtcttgacatcaaaggataagattactaagcgg
atgattgtggtattagcgatggcatccctcgagacacacaagatatcgtccaacgggcct
ggtggtgacaaatatgtccttttgaactgtgacgaccatcaaggtttattaaaaaaaatg
ggtagagacattagtgaagcaagacctgatattacccaccaatgtcttttgacgttgcta
gattctccaatcaacaaagccggaaagctgcaggtctatattcaaacaagtcgaggaatt
ctgatcgaggttaaccccactgttcgtataccaagaactttcaaaagattttcaggttta
atggttcagttactacataagctttctatcagatcggtaaattctgaagaaaagttactt
aaagtcattaagaacccaattaccgatcacctacctactaagtgccgtaaggtgacatta
tcctttgacgcaccagttatccgcgttcaagattacatcgaaaaactagacgatgatgaa
agtatatgtgtctttgttggtgccatggcaagaggtaaagataactttgcggatgaatac
gtcgacgaaaaagtcggcttgtccaattacccattgtctgcctcagttgcatgttctaaa
ttttgccatggcgctgaagatgcttggaatattttatag

DBGET integrated database retrieval system