KEGG   Saccharomyces cerevisiae (budding yeast): YLR187WHelp
Entry
YLR187W           CDS       T00005                                 

Gene name
SKG3
Definition
(RefSeq) Skg3p
  KO
K12609  CCR4-NOT transcriptional complex subunit CAF120
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YLR187W (SKG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YLR187W (SKG3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     YLR187W (SKG3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PH PPV_E1_N
Motif
Other DBs
NCBI-GeneID: 850884
NCBI-ProteinID: NP_013288
SGD: S000004177
UniProt: Q06315
Position
XII:524865..527945
Genome map
AA seq 1026 aa AA seqDB search
MKRIFSGVKSPKLSAPPKVFKNDESPSTPSSPKFDQGLRSLSASASRLFSNSISTPGSPT
LDLPQEHSINGDISPELVPIVTLLSAQAHRRYHYGIFLILHDLKTDGTPAARQWEECYGV
LLGTQLALWDAKELSDSKNNKNTSTMKKAASRPSFINFTDASVRSLDANDQVIIASENEK
TKKDLDNVLVVSTTLKNRYFLKFKNSKSFKTWNAAIRLSLFEFTALQEAYTGSFLSSRGV
KLGDIKVVMADTKFTYEDWVSVRFGTGMPWKRCYAVISPQSGKKKKNSKGSICFYENNKK
TKKSNIMTTVVDARALYAVYPSSPILIDTSTIIKLEGFVSFDKSEEPQETNLFIMPEKHQ
GVPGYDTIIRFLIPAMNAFYLYGRPKGLIANRTDPDSLLFALPTLPHIYYLQVDDVLSLT
KDKNYIHWSAADWRNNIVQVLQKKLSKGYKGCGNKTVSVSSGMMKSPAISSAELFEGYDS
LPERQMESPQKSKMKSPTLASTDDINSASASVNSHATSVKQTELFVTDNSSKINDSVSAQ
SSVTTNFKDTFTTPMTSGMLNHENSERSFGSGLKLKITDSNLENMEDVEAKSANEFSTTP
EDKHIHLANAAELSALYDKYSTSPFGKSEANSSPKPQKLEVKDRSKNENRSPYERYVGTS
AESKTFEIGNVRESKSTINTSLSSPLRVEDSRRSKNEDLGSLKEFEELSQKISNMGMANI
SSEALSDTAENSSFVTDLNLNINNSSSVNLNEEQRVPDFGEENVFDPDYMEQNQMLETES
RYTTDEFDFSDNQDAASSNYSNGQTNRTVTETLSASDRNDKIPHSSLFTNLNQLTSNGGN
YQDREDFSGDQINKPQQSQPLHVKGPQTSSFGYRNSSANSSQPQAPYPVGRPLGKIRTGP
LTVQPMQQGGNSSMYSFQSSQHRFHSSQQRQNQSLSFRNNTYGSGNNQNTFHPSPQLQQQ
PQNMRYLNNKLPINDRSPIPQTQHHVPDGRPSLHINTTNRTNPLTAQSGFSQFMPPNSTS
TNPYSS
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggattttctctggtgtgaagtccccaaagttatctgctcccccaaaagttttc
aaaaatgatgagagcccatccactccgagctctcccaaattcgaccaagggcttcgaagt
ttatcagcatcagcttcaagactcttcagtaactcaatatccactcctgggagccctacg
ttagatcttccgcaagaacactctattaatggtgatatctcaccagaactagtaccaatc
gttactttactctctgcacaggctcataggagataccattatggtatattcttgatatta
catgatttgaagacagacggaacacctgccgcgcgtcagtgggaagaatgctatggtgtg
ttgctaggaactcagctggctttatgggatgcaaaagaattatcagattccaagaataat
aagaacacatcaaccatgaaaaaagccgcatcgagaccttcttttatcaattttacagat
gcttctgtgaggagtttggacgctaatgatcaggtaatcattgcatcagagaacgaaaag
acaaagaaagatctagacaatgttcttgttgtttcaacaactttaaaaaacaggtatttc
ttaaaattcaaaaattcaaaatcattcaaaacttggaacgcagcaattaggcttagtttg
ttcgagtttacggcgttgcaagaggcctacacgggctcatttttgtcaagcagaggtgtt
aaacttggtgatatcaaagttgttatggcagatacaaaattcacttatgaggactgggtt
agcgtaagattcgggacaggtatgccatggaaacgttgttatgctgttatttctccacag
tctggcaaaaaaaagaaaaattcgaaaggttcaatatgtttctatgaaaataacaaaaaa
accaaaaaatcaaacataatgacaacggtagtagatgcacgggctttatatgccgtttat
ccttcctcgccgatattaatcgacacatctacaatcataaaattggaaggttttgtctct
tttgacaaaagtgaggaacctcaagaaaccaacctatttatcatgcctgaaaagcatcaa
ggtgttccgggatatgacactattattcgcttcttaatcccagctatgaacgcgttctac
ttatatggtaggccaaagggtttgattgccaacagaactgacccagactccctgctgttt
gccttacccactcttccgcatatatattatttgcaggtggatgacgttttatcattaaca
aaagacaaaaattacatacattggagtgctgctgattggaggaataacattgttcaagta
ttacagaaaaaattaagtaagggctataaaggctgtggtaataaaactgtatcagtttca
tctgggatgatgaagtcgccggcaattagttcagctgaattatttgaagggtacgattct
ctccctgaaagacaaatggaaagtccgcaaaaatctaagatgaagtctcctacattagca
tcgaccgatgatattaattccgcttctgcttccgtaaactcacatgctacctcagtaaaa
caaactgaattatttgtgactgataattcttcaaaaatcaatgactctgtgtcggcgcag
tccagtgtcactactaacttcaaagatacttttaccaccccaatgacatcaggaatgctc
aaccatgaaaattcagagagaagctttggttcaggattaaaactcaaaatcactgattca
aatttggaaaatatggaagacgttgaagcgaaatctgctaacgaattctctacgacacca
gaagacaaacatattcacctcgccaatgcagccgaattatccgccctttacgacaaatat
tccacatctccgtttggtaaatcggaggctaattcaagccctaaacctcaaaaattggaa
gttaaagatcggtcaaaaaatgaaaacagaagcccctatgagagatacgtaggtacatcc
gctgaaagcaagacatttgaaataggtaacgtcagagagtcgaaaagtacgataaatact
tccctttcttcgcctttgagggtagaagatagtagacgttcaaaaaatgaggacctggga
tctttgaaagagtttgaagagttatctcaaaagattagcaatatgggaatggcaaatatt
tcttcagaagctttaagtgacacagcagaaaacagttcttttgttacggacctgaacttg
aatatcaataacagttcatcggtcaatctcaatgaagaacaacgtgtgccggattttggg
gaggaaaacgtatttgatccagattatatggaacaaaaccaaatgttggaaacagaaagt
aggtacactacggatgagtttgacttttcagataatcaggatgcagcatccagtaattat
agcaatgggcaaaccaaccgaacagtaactgaaaccctttctgccagtgacagaaatgac
aagatcccacattcttctttatttacaaacttaaaccagcttacttcgaatggaggaaac
tatcaggatagggaagatttctctggtgatcaaataaacaaacctcaacaatctcaacca
cttcatgtgaaaggaccacaaacttcgtcatttggttacagaaattcttcagccaatagc
tcgcagcctcaagcaccatacccggttggtcgcccgttaggtaagataagaacgggtccg
ctgaccgtccagcctatgcaacaaggtggaaactcatcaatgtattctttccaatcttcg
caacatcggtttcattcgtcgcaacagcgccaaaaccaatcactttccttcagaaacaat
acctatggaagtggtaacaatcaaaatacattccatccatcgccgcaactgcaacaacag
cctcaaaatatgagatatttgaataataagttaccaataaatgatagatctccaataccg
caaacacagcaccatgtaccagatggccgtcccagcctccatataaataccactaaccgc
acaaatccgcttactgcacaaagtggattttctcaatttatgcctcccaatagcacatca
accaacccatattccagctga

DBGET integrated database retrieval system