KEGG   Saccharomyces cerevisiae (budding yeast): YLR188WHelp
Entry
YLR188W           CDS       T00005                                 

Gene name
MDL1
Definition
(RefSeq) ATP-binding cassette permease MDL1
  KO
K02021  putative ABC transport system ATP-binding protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YLR188W (MDL1)
Transporters [BR:sce02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    YLR188W (MDL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_16 AAA_21 AAA_29 AAA AAA_5 AAA_7 AAA_18 AAA_33 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 850885
NCBI-ProteinID: NP_013289
SGD: S000004178
UniProt: P33310
Position
XII:528300..530387
Genome map
AA seq 695 aa AA seqDB search
MIVRMIRLCKGPKLLRSQFASASALYSTKSLFKPPMYQKAEINLIIPHRKHFLLRSIRLQ
SDIAQGKKSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAV
PSVIGKLLDLASESDGEDEEGSKSNKLYGFTKKQFFTALGAVFIIGAVANASRIIILKVT
GERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQ
GFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLN
ATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTS
MIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTI
GKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLL
LRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQD
DRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEA
TSALDSQSEEIVAKNLQRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDL
IAIPNSELNALLAEQQDEEGKGGVIDLDNSVAREV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaagaatgatacgtctttgtaaaggtccaaagttgttgcgaagtcaattcgca
tcagcaagtgcactatattcaaccaagtcattgttcaaacctcccatgtaccaaaaagcg
gaaattaatttgattattccacatagaaagcactttttgttgcggtcgattcgattacaa
tcagacattgcgcaaggaaagaagtccaccaagcccactttaaagttgtccaatgcaaat
tcaaaatcctcggggtttaaagacattaaacggctattcgtcttatctaaaccggaatcc
aagtacattggtcttgccctccttttaatcctcatttcaagttcagttagtatggctgta
ccttccgttatcggtaaattattagacttggcttccgaaagtgacggcgaagatgaagag
ggctcaaaaagcaataagttatatggttttacgaagaagcaatttttcacagcattagga
gcagtatttataattggagcagttgctaatgcaagcagaatcatcattttaaaggtcacc
ggtgagagactggtcgcaagattaagaacgagaacaatgaaagctgcattagatcaagat
gccacatttttagatactaatcgtgtcggtgatttgatctcaagattatcatctgatgca
tctatagtggccaaatcggtcacacaaaacgtctctgatggaacaagggcaattattcaa
gggtttgtcggttttggcatgatgagcttcctctcgtggaaattgacttgcgtaatgatg
attttagcccctcctttaggtgctatggcactgatatatggtaggaaaatacgaaaccta
tcaagacagttacaaacctcagtaggtgggttaacaaaagtggcagaagagcaattaaat
gctactaggacaattcaagcatatggtggtgaaaaaaacgaggttcgccgctatgcaaaa
gaggttagaaatgtatttcatattggtctgaaggaagcggttacttccggtttattcttc
ggaagtactgggctagttggcaacactgcaatgctgtcgttattattggttggaacaagc
atgattcaaagtggttcaatgactgtcggtgaattatctagtttcatgatgtatgccgtg
tataccggaagttcattatttggtttatcgagcttctattcagaacttatgaaaggtgct
ggtgcggctgccagggtttttgaattaaatgaccgtaagccattgattcgtccgactatt
ggaaaggatcctgtgtcattagcccaaaaacccatcgttttcaaaaacgtgtcattcact
tatcccactcggcccaaacaccagattttcaaggatttgaatattactatcaagcctggt
gaacacgtttgcgctgtcggtccatcaggaagcggcaaatcaacaattgcgtctttgttg
ctcaggtactacgatgtgaactcaggatcgatcgaatttggtgatgaagacatcagaaat
ttcaacttgaggaagtatcgaagactaataggatacgtgcaacaagaaccactacttttc
aatgggactattctggacaatatcctctactgcattccgcctgaaattgcggagcaggat
gatcgtattagacgtgctattggaaaagctaattgcacaaaatttttggccaattttcca
gatggattgcagactatggttggtgctagaggcgcgcaattgtccggtggtcaaaagcaa
agaattgcattagctagagcgtttttactagatcctgccgtccttattttagatgaagca
accagtgcccttgactctcaaagtgaagaaatagttgccaaaaatcttcagagacgtgtg
gaaagggggttcactactatatcaattgcacataggctttcgacgatcaaacacagtact
agggtgattgtgttaggaaaacatggctcagtggttgaaaccggttcattccgagatcta
atcgccattcctaatagtgaactaaatgcgctgcttgccgaacagcaggacgaggaagga
aaagggggagtgatagatttggacaatagtgttgcccgggaagtataa

DBGET integrated database retrieval system