KEGG   Saccharomyces cerevisiae (budding yeast): YLR207W
Entry
YLR207W           CDS       T00005                                 
Symbol
HRD3
Name
(RefSeq) ubiquitin ligase complex subunit HRD3
  KO
K14023  ERAD-associated E3 ubiquitin-protein ligase component HRD3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YLR207W (HRD3)
SSDB
Motif
Pfam: Sel1 Baculo_E66 TPR_12 TPR_19
Other DBs
NCBI-GeneID: 850904
NCBI-ProteinID: NP_013308
SGD: S000004197
UniProt: Q05787
Structure
Position
XII:556788..559289
AA seq 833 aa
MITLLLYLCVICNAIVLIRADSIADPWPEARHLLNTIAKSRDPMKEAAMEPNADEFVGFY
VPMDYSPRNEEKNYQSIWQNEITDSQRHIYELLVQSSEQFNNSEATYTLSQIHLWSQYNF
PHNMTLAHKYLEKFNDLTHFTNHSAIFDLAVMYATGGCASGNDQTVIPQDSAKALLYYQR
AAQLGNLKAKQVLAYKYYSGFNVPRNFHKSLVLYRDIAEQLRKSYSRDEWDIVFPYWESY
NVRISDFESGLLGKGLNSVPSSTVRKRTTRPDIGSPFIAQVNGVQMTLQIEPMGRFAFNG
NDGNINGDEDDEDASERRIIRIYYAALNDYKGTYSQSRNCERAKNLLELTYKEFQPHVDN
LDPLQVFYYVRCLQLLGHMYFTGEGSSKPNIHMAEEILTTSLEISRRAQGPIGRACIDLG
LINQYITNNISQAISYYMKAMKTQANNGIVEFQLSKLATSFPEEKIGDPFNLMETAYLNG
FIPAIYEFAVMIESGMNSKSSVENTAYLFKTFVDKNEAIMAPKLRTAFAALINDRSEVAL
WAYSQLAEQGYETAQVSAAYLMYQLPYEFEDPPRTTDQRKTLAISYYTRAFKQGNIDAGV
VAGDIYFQMQNYSKAMALYQGAALKYSIQAIWNLGYMHEHGLGVNRDFHLAKRYYDQVSE
HDHRFYLASKLSVLKLHLKSWLTWITREKVNYWKPSSPLNPNEDTQHSKTSWYKQLTKIL
QRMRHKEDSDKAAEDSHKHRTVVQNGANHRGDDQEEASEILGFQMEDLVTMGCILGIFLL
SILMSTLAARRGWNVRFNGAQLNANGNRQQEQQQQQQAQGPPGWDFNVQIFAI
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgataacactcttattatacctgtgcgtaatatgtaacgcaatagtgttaataagggct
gattcgatagcggacccttggcctgaagcgcgacatctactaaataccatagctaagtcc
agagacccaatgaaagaagctgctatggaacccaatgcagatgaatttgttggattctat
gtaccgatggattattccccacgtaatgaggaaaaaaactaccagagcatttggcaaaac
gaaatcacagattctcaacgtcatatttatgaattacttgtacaatcaagtgaacaattc
aacaactcagaagcaacatatacacttagccagattcacctttggagtcaatataatttc
ccgcataatatgactttggcacacaaatacttagaaaaattcaatgatctaacccacttc
accaatcattcggccatcttcgacttagctgtgatgtatgccactgggggatgtgcttct
ggtaatgatcaaaccgtgatccctcaggattctgctaaagcactgctatattaccaaagg
gctgcccaactagggaatttaaaggctaagcaagtgctagcttataaatactattctggc
ttcaatgtcccacgaaattttcataaatctttagtattgtacagggacattgctgaacag
ctgagaaagtcgtactccagggacgaatgggatattgtcttcccctattgggaaagttac
aacgtgagaatatcggattttgagagtggcctattaggtaaaggtttgaattccgttcca
tcttctacagtaaggaaaagaactacgagaccagatattggttcaccctttattgcgcaa
gttaacggtgtacagatgaccttgcaaatcgaaccgatgggtaggttcgctttcaacggt
aacgatggcaacataaatggcgacgaagatgacgaggatgccagtgaaagacgaatcatt
cggatatattatgcagctttgaatgattataaaggaacatattcacaaagcagaaattgt
gagcgcgccaaaaacttgttggaattaacgtacaaggaatttcagcctcatgtcgacaat
ttggatcctttgcaagtattttactacgtccgttgcttacaattattggggcacatgtat
ttcaccggcgaaggctcctcgaagcctaatattcatatggccgaagagatcctgaccacg
tcgctagaaataagcagaagggcacagggacctataggtagagcgtgcatagatctgggc
ttaataaatcaatacatcacaaacaatatttctcaagcaatttcgtattatatgaaagct
atgaaaacacaagctaacaatggaatcgtagaattccaattatccaaattggccacttca
ttccctgaagaaaaaatcggcgacccatttaacttaatggaaactgcctacttgaatgga
ttcattccagccatatatgagtttgcagtaatgatcgaatctggaatgaacagtaagagt
agtgtggaaaacactgcttacctgttcaaaacattcgttgacaaaaacgaagctattatg
gcacctaaactgaggacagcatttgccgcattaatcaacgatcgttcagaagtggcttta
tgggcttattcccaactagccgagcaaggctacgagactgctcaagtctctgccgcctac
ttaatgtaccagttgccatatgagtttgaggatcctccaagaaccacagatcagagaaaa
actttggcaatttcctactatacaagagcgtttaaacagggaaatatagatgctggtgtt
gtcgcgggagatatctattttcagatgcagaattacagtaaagctatggctctttatcag
ggtgcagctttgaagtactctatacaggctatctggaacttagggtacatgcatgagcat
gggctaggtgtaaacagagatttccatcttgctaaacgttactacgaccaagtttcagaa
cacgatcatagattttacttggcttccaaattgagtgttttaaaattacacctaaagtca
tggttgacttggatcaccagagaaaaagtaaactactggaaaccttcctcgccacttaac
cctaacgaagatactcagcactcgaagacttcatggtacaagcaattgacgaagattcta
caaagaatgagacataaggaggatagtgacaaagctgcggaagattctcacaaacacaga
actgtagtgcagaatggagctaaccataggggtgacgaccaagaggaggcttccgagatt
ttgggcttccaaatggaggatcttgttacgatgggatgtatcttggggatattcctatta
agtatattaatgagtacactggcggcccgtagaggctggaatgtccgtttcaatggagca
caattaaatgcaaatggtaaccggcagcaagagcaacaacaacaacaacaagcacaaggt
cccccgggctgggacttcaatgttcagatattcgccatatga

DBGET integrated database retrieval system