KEGG   Saccharomyces cerevisiae (budding yeast): YLR209C
Entry
YLR209C           CDS       T00005                                 

Gene name
PNP1
Definition
(RefSeq) purine-nucleoside phosphorylase
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00240  Pyrimidine metabolism
sce00760  Nicotinate and nicotinamide metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YLR209C (PNP1)
   00240 Pyrimidine metabolism
    YLR209C (PNP1)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YLR209C (PNP1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     YLR209C (PNP1)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 850906
NCBI-ProteinID: NP_013310
SGD: S000004199
UniProt: Q05788
Position
XII:complement(560797..561732)
AA seq 311 aa
MSDILNVSQQREAITKAAAYISAILEPHFKNTTNFEPPRTLIICGSGLGGISTKLSRDNP
PPVTVPYQDIPGFKKSTVPGHSGTLMFGSMNGSPVVLMNGRLHGYEGNTLFETTFPIRVL
NHMGHVRNLIVTNAAGGINAKYQACDLMCIYDHLNIPGLAGQHPLRGPNLDEDGPRFLAL
SDAYDLELRKLLFKKWKELKIQRPLHEGTYTFVSGPTFETRAESKMIRMLGGDAVGMSTV
PEVIVARHCGWRVLALSLITNTCVVDSPASALDESPVPLEKGKATHAEVLENGKIASNDV
QNLIAAVMGEL
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagtgatatcttgaacgtaagtcaacaacgtgaagcaattaccaaggccgctgcgtat
atttctgctattttagaaccacatttcaaaaatacaacaaatttcgagcctccgagaact
ttgattatatgtggttcagggcttggtggaatatctaccaagctgtctagagacaatcca
cccccggtaacagtcccataccaagacatcccaggattcaagaaaagtacggttccaggt
cattccggtacactaatgttcggatctatgaatggttcaccagtagtattaatgaatggt
cgtcttcatggatatgaaggcaacacattgtttgagactacttttcctattagagtgctt
aaccacatgggtcatgttcgtaatttaattgtcactaatgccgctggtggtataaacgcg
aaatatcaagcctgcgatttgatgtgcatttatgatcatttaaatatccctggccttgct
ggccagcacccattgagaggtcctaacttggatgaagatggacctcgttttttagccttg
agtgatgcatatgatctggagttgaggaagcttttatttaagaaatggaaagagctcaag
attcaaaggccactgcatgaaggtacttatacttttgtatctggacccactttcgaaaca
agagcagaatccaaaatgataaggatgttgggaggagatgctgtcggaatgagtactgtt
cccgaagtcattgttgcaagacattgcggatggagggttttggccttaagtttgattacc
aatacttgcgtggtggatagccctgccagtgcgttggacgaatcacctgtacccttagaa
aaaggcaaagcgactcacgctgaagtactggagaatggtaaaatcgcctctaatgacgtg
caaaacttaattgctgccgtaatgggggaattataa

DBGET integrated database retrieval system