KEGG   Saccharomyces cerevisiae (budding yeast): YLR212C
Entry
YLR212C           CDS       T00005                                 

Gene name
TUB4
Definition
(RefSeq) gamma-tubulin
  KO
K10389  tubulin gamma
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR212C (TUB4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YLR212C (TUB4)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     YLR212C (TUB4)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    YLR212C (TUB4)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2
Other DBs
NCBI-GeneID: 850909
NCBI-ProteinID: NP_013313
SGD: S000004202
UniProt: P53378
Structure
PDB: 
5FLZ 5FM1

Position
XII:complement(564860..566281)
AA seq 473 aa
MGGEIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSRN
KFTPRAIMMDSEPSVIADVENTFRGFFDPRNTWVASDGASAGNSWANGYDIGTRNQDDIL
NKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPARSSEV
VVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTN
SIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLD
PSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRS
PYLPLQPNENEVSGMMLSNMSTVVNVFENACNTFDKVFAKGAFLNNYNVGDLFQSMQNVQ
DEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgggtggagaaattattactttgcaagcaggtcaatgcgggaaccacgttggtaagttt
ctctggtctcaattggcgaaagaacacgctataggcaccgatgggctatctcagcttcct
gattccagtacggaaagagatgatgacacaaagcctttcttccgcgaaaacagtaggaat
aagtttacgccaagggctattatgatggattccgagcctagtgtcatcgccgacgtggag
aacacatttcgtgggtttttcgacccaagaaatacctgggtagcttctgatggcgctagc
gctggtaattcttgggccaatgggtatgatataggaactcgtaaccaggatgatattctt
aacaagatcgacaaggagattgattctaccgacaatttcgaaggtttccagttgctgcac
tcagtagccggagggaccggttcagggctcggatccaacctcttagaagcgctgtgtgat
cgatatcctaaaaaaatactcacgacatattctgtgttccctgcaagatcttctgaggtt
gttgttcaatcttataacactattctggctttgagaagactgatagaagatagcgatgca
acggtggtgtttgataacgcttcgttgctgaatatttccggtaaagtgtttagaaatccg
aacatcgatttacaacacacgaatcaattgatatcgaccataatatcttcagtaacgaac
agtatacggtttccgagttacatgtattcatccatgtccagtatttactctaccttgatt
ccttctcctgaacttcatttcctaagccctagtttcactccatttacatcagattatatt
cacgatgatatagcgcataaaggccattccagttatgacgtcatgttagatttattagac
ccttccaattctcttgtctctaccgcgatgaacaatccaacatattttaacgtttataat
acaatcattggtaatgtagaacctcgtcagatatcgcgtgctatgaccaaattacaacaa
cgcatcaaattcccctcatggtcctcttctgcgatgcacgttaacattggaagaagatcg
ccatacttgcctttacaaccaaatgaaaacgaagttagcggcatgatgttaagcaatatg
tctaccgtggtgaacgtctttgagaatgcgtgcaatacttttgacaaagtatttgccaag
ggcgcatttttaaataattataatgtaggcgacttgttccaatcaatgcagaacgttcaa
gatgaattcgccgagtcaagagaagtagtacaaagcctgatggaggattatgtagctgca
gaacaagattcgtacttggacgatgtacttgttgatgatgaaaatatggttggcgagttg
gaagaggacctggatgccgacggtgatcataaattagtataa

DBGET integrated database retrieval system