KEGG   Saccharomyces cerevisiae (budding yeast): YLR220WHelp
Entry
YLR220W           CDS       T00005                                 

Gene name
CCC1
Definition
(RefSeq) Ccc1p
  KO
K22736  vacuolar iron transporter family protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YLR220W (CCC1)
Transporters [BR:sce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   YLR220W (CCC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VIT1 T3RM_EcoP15I_C CsgG
Motif
Other DBs
NCBI-GeneID: 850917
NCBI-ProteinID: NP_013321
SGD: S000004210
UniProt: P47818
Position
XII:576825..577793
Genome map
AA seq 322 aa AA seqDB search
MSIVALKNAVVTLIQKAKGSGGTSELGGSESTPLLRGSNSNSSRHDNLSSSSSDIIYGRN
SAQDLENSPMSVGKDNRNGDNGSDNEKANLGFFQSVDPRVISDLIIGLSDGLTVPFALTA
GLSSLGDAKLVITGGFAELISGAISMGLGGYLGAKSESDYYHAEVKKEKRKFYDNSNLIN
REIEDILLEINPNFSDETIVSFIKDLQRTPELMVDFIIRYGRGLDEPAENRELISAVTIG
GGYLLGGLVPLVPYFFVSDVGTGLIYSIIVMVVTLFWFGYVKTKLSMGSGSSTSKKVTEG
VEMVVVGGVAAGAAWFFVKLLG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtccattgtagcactaaagaacgcagtggtgacccttatacagaaagcgaaaggtagt
ggtggaacctcagagttgggggggtctgaatcaactcccttgttgaggggtagtaatagc
aatagttcaaggcatgataacttatcctcatctagctcggatattatctatggtagaaat
tcagcgcaggatctagaaaactcaccgatgtcagtagggaaagataataggaatggcgat
aacggttcggataacgaaaaggcgaacctagggttcttccaatcagtagatcctcgcgta
attagcgatttgattatcgggctaagcgacggtttaaccgtcccctttgctctaacagct
ggtctatcttcacttggtgatgcgaaattggtcattaccggtggctttgctgagttgatc
tcaggtgcgatttctatgggccttggtggctatttgggagcgaagagtgaatctgattat
tatcatgctgaagtaaagaaggagaaaaggaaattttacgataactccaacctaattaac
agagaaattgaagacattctgttagagattaaccctaatttctcggacgaaacaatcgtt
tcgttcatcaaagatttacaaagaacacctgagctaatggttgacttcattatcaggtac
ggtaggggtctagacgaacctgccgagaatagagaactaatcagtgcagtcactatcggt
ggcggttatctacttggtgggctagtaccactagtgccatatttttttgtctcagatgtg
ggcacaggtctcatttattctataatagtcatggttgtaacattattctggtttggttac
gtaaagacaaaactatccatgggtagtggcagttcgacttcaaagaaagttacggaaggt
gttgaaatggttgttgtgggtggtgtagcagcaggtgcggcttggttctttgttaagtta
ctgggttaa

DBGET integrated database retrieval system