KEGG   Saccharomyces cerevisiae (budding yeast): YLR225CHelp
Entry
YLR225C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Svf1_C Svf1 FAD_binding_6
Motif
Other DBs
NCBI-GeneID: 850922
NCBI-ProteinID: NP_013326
SGD: S000004215
UniProt: Q05948
Position
XII:complement(587695..588918)
Genome map
AA seq 407 aa AA seqDB search
MAVAIKKEKTKFAPVKEVLSEKDHANYTKFQDTSKLEWFCRTSNHKKFKSHSLLKAVRNP
TETRIETQTLYFTDLTNGKCGLIQLLYSSVMGGIYKGFQLNFKIFKASSEENSEEDIDIW
ESFKIDNIKDFDTLKVESDNVTFHFVPLENSSSSGFAQLLIKIDIPKGSTSCLLKDLKVD
ITVNLQEGFIINPDGSNYYLDKSISLEELAKRDSSSTSRKMIRHVFVPRGFCNGTISYKK
NDKPVKLDLKDTPMLYLDAVQGLIPNKAASKWNFLCFNGEKRSMMCIEFTTTKEYGSTTV
TIWAVSDKDKILEVGSSVNDHAVKFPSTKEDKQNGWKYPTSISFPRGFEESNLRLVNRYD
IMSELPAFIRSIAENLANMKPFIYQFCQKSKFDDDEGVSIIESTFIN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgcgatcaaaaaggagaagacgaaatttgcccccgttaaggaagttttatcc
gagaaggatcatgctaattatactaaatttcaggatacatcgaaactagaatggttttgc
aggacgtcaaatcacaaaaagttcaagtcacatagtttattaaaagcagtaagaaatcca
acggaaacaagaatagagacacaaactctgtattttacggatctcaccaacggcaaatgt
ggattaattcaactattatattccagtgttatgggcggtatatacaaaggttttcagtta
aatttcaaaatatttaaagccagcagtgaggaaaactctgaagaagacattgatatatgg
gaaagctttaaaattgataatatcaaagattttgatacgttaaaagttgaatcggacaat
gttacgtttcacttcgtacctttggaaaattcttcctccagtggatttgctcaattatta
attaagatagatattccgaagggaagtacaagctgtttactaaaagatttgaaggttgac
attaccgtaaatttacaagaaggattcataataaacccggacggttccaattattacctt
gacaagagcatcagcttggaagagttagcaaaaagagactcttctagtacgtccagaaaa
atgataagacatgtttttgttcctagaggtttttgcaatggtaccatctcatacaagaaa
aacgataaacctgtgaagctggacttgaaggacacgcctatgttgtatctggatgctgtc
caggggctaatacccaataaggcggctagtaaatggaattttctttgtttcaatggtgag
aagcgttcgatgatgtgtattgaattcaccacaacaaaagaatatggcagcactacagtg
actatatgggcggttagtgataaggacaaaattttggaggtcgggtcaagtgtaaatgat
catgctgttaaatttccatctacaaaagaggataagcaaaatggttggaaatatcctaca
tccatttcatttccgcgtggttttgaagaatctaatttaagattagtcaataggtacgat
ataatgagtgagctgcccgctttcattaggtctattgctgaaaatctggcaaacatgaag
ccattcatttaccaattctgccagaagtctaaattcgatgacgatgaaggagtttccatc
attgaaagtacatttatcaattga

DBGET integrated database retrieval system