KEGG   Saccharomyces cerevisiae (budding yeast): YLR226WHelp
Entry
YLR226W           CDS       T00005                                 

Gene name
BUR2, CST4
Definition
(RefSeq) Bur2p
  KO
K15563  protein BUR2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YLR226W (BUR2)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    BUR kinase complex
     YLR226W (BUR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 850923
NCBI-ProteinID: NP_013327
SGD: S000004216
UniProt: Q05949
Position
XII:589354..590541
Genome map
AA seq 395 aa AA seqDB search
MSATSSSGDVKKFQAVPKPTSNASPPPASSGFNARTLWPDLIETPENQWVFECKDIIEKI
GTNGPIAVEIKKNMEKCLMYFYTLKKKLNLFDHTYTASCILFYRYWFIYGIPTAITECIH
ISQGILVTACKTMENNRPIEAYIKATCEFLMQNIPSLKSRTNIDKLKWEFRDKLVTNEKK
ILCLFGFDLNISNPKELIEEVFSGYYRFNRDHNLPENFKKAFPKILQESRNFMVQAVTQP
VSLLCDGYTFIVLSLIYCGLEYKKLVDKDFRYPKNFFKDRFPIEVTPENFANIFTDYKLL
EENFFNLKSNKGAKLQIDSSMIDSVIDESGDVENEVSEISDPFNYELIKSGEVKEEFLNH
IETRVKDLLDKAKQESMKRKAKDPIRTPDAKKPKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctacatcttcaagtggtgacgtgaaaaaatttcaagctgtaccaaaaccaacg
agcaatgcatcaccaccaccagcatcgagtgggtttaacgcaaggaccctatggccggat
ttgatagaaacaccagaaaaccagtgggtttttgagtgcaaagatattattgaaaagata
ggcactaatggaccgatagcagtggaaataaaaaaaaatatggaaaaatgcttaatgtac
ttttacacacttaaaaaaaaattaaatctttttgatcacacctatacggcatcatgcatt
ctattttacaggtattggttcatatatggaatacctacagccataactgaatgtattcat
atatcacagggaattctggtcaccgcttgcaaaacaatggagaataataggcctatagag
gcctatattaaggcgacttgtgagtttttgatgcaaaatataccgtctttaaaaagtcga
acaaatattgataaacttaaatgggaatttagagataagttagtgacgaatgaaaaaaaa
atactatgtttatttggctttgacttaaatatcagtaatccaaaagaattgattgaagaa
gtgttcagtggctattatagattcaacagggatcacaatctgccagaaaactttaaaaaa
gcttttccaaaaattcttcaagaatcaagaaattttatggtccaagctgtcacccagcca
gtttctttattgtgcgacggttatacgttcattgtactatctctcatatactgtggttta
gagtataaaaagcttgtagacaaagatttcagatatccgaaaaacttcttcaaggataga
ttccctatcgaagtaacgccggaaaattttgccaatatctttaccgattacaagttactg
gaagagaattttttcaacttaaaaagtaataaaggtgctaaattacaaattgattcaagc
atgattgattcggtgattgacgaaagtggcgatgtggaaaatgaagtttcagaaatctct
gatccgtttaactacgagttgattaaatccggtgaggtgaaggaagagtttttgaatcat
attgaaacaagggttaaagatttactagataaggctaaacaagaaagtatgaagagaaag
gctaaagatcctataagaaccccagatgccaaaaaacctaaaatataa

DBGET integrated database retrieval system