KEGG   Saccharomyces cerevisiae (budding yeast): YLR231CHelp
Entry
YLR231C           CDS       T00005                                 

Gene name
BNA5
Definition
(RefSeq) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00380  Tryptophan metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    YLR231C (BNA5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     YLR231C (BNA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 850933
NCBI-ProteinID: NP_013332
SGD: S000004221
UniProt: Q05979
Position
XII:complement(605758..607119)
Genome map
AA seq 453 aa AA seqDB search
MEKALELDGEYPESLRDEFNIPTFKSMGLSSDDKPVTYLCGNSLGLMPKSTRNSINAELD
AWSDCAVESHFKHPEEARGKVPWVSIDLPILPLLAPIVGAQENEVAVMNSLTANLNSLLI
TFYKPTEKRFKILFEKGSFPSDYYAFYNQCKIHGISEPENVFIQIEPREGETYIRTQDIL
DTIEVNQDELALVCLSGVQYYTGQYFDIGRITSFAHQFPDILVGWDLAHAVGNVPLQLHD
WGVDFACWCSYKYLNAGPGGIGGLFVHSKHTKPDPAKESLPRLAGWWGNDPAKRFQMLEV
FEPIPGALGFRQSNPSVIDTVALRSSLELFAKFNGINEVRKRSLLLTNYMTELLEASKYY
KHPLRIEKLPCFFTILTPTSTDEEHGAQLSLYFDSDTGKEDIMPKVFQYLHDHGVIGDAR
RPNVIRLAPAPLYNTFSDVYIAVNALNEAMDKL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagctttggaattagacggagaatatccggaatctctgagggatgaattcaac
atccctacatttaaatccatgggactatcgtccgacgataagcctgtgacgtacttatgc
gggaattctttaggtttgatgccgaagtcaactaggaattcaattaatgctgagctagat
gcgtggagcgattgtgctgtggaatcgcatttcaaacatcctgaagaagccagaggaaag
gtgccttgggtcagcattgacttacctattcttccactactagcccccatcgtgggtgct
caagaaaatgaagttgcagtaatgaatagtctcactgcaaatttgaattcattgttaatt
acgttttataaacctactgagaaaagattcaagatcctttttgaaaagggctcctttcca
tcagactattatgctttctacaaccagtgcaaaattcatggaatttcggaacctgagaat
gtttttattcagatcgagccacgcgagggagagacttatatcagaactcaagatatcctg
gataccatagaggtaaatcaagatgaattggcgctggtctgtttgtcaggtgttcagtat
tacacggggcaatatttcgatattggccgaatcacctcatttgcccaccaattccccgac
atattggttggatgggatttagcacacgctgtagggaacgtcccattgcaacttcatgat
tggggtgttgactttgcctgttggtgttcttacaagtacttgaatgccgggcctggtgga
attggtggcttatttgtccactcgaagcatactaaaccagaccctgctaaggaaagtttg
ccaagattagctggttggtggggcaatgatcctgctaagcgatttcaaatgctggaagta
ttcgagccgattccaggagcattgggattcaggcaatctaatccaagcgttattgacaca
gtggcattgagaagttcattggaattatttgcgaagtttaatggtattaatgaagttcgt
aaaagatcgttgttgctgacgaactatatgacggaactgttggaagcctccaagtattac
aaacaccctttaaggatcgagaaattaccatgtttttttacaatattaactccaacaagc
acagatgaagaacatggcgcccaattgtcactttacttcgattctgacactggaaaagag
gatattatgcccaaagttttccaatatttgcatgaccatggtgtcattggcgatgcaaga
agaccaaacgtaattagattggctcctgctcccttatataatacattttcagatgtatac
attgcggtgaatgcactaaatgaggcgatggataagttgtag

DBGET integrated database retrieval system