KEGG   Saccharomyces cerevisiae (budding yeast): YLR256W-AHelp
Entry
YLR256W-A         CDS       T00005                                 

Definition
(RefSeq) gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYA Retrotran_gag_2 CttA_N
Motif
Other DBs
NCBI-GeneID: 850959
NCBI-ProteinID: NP_058173
SGD: S000007377
UniProt: P0C2I8
Position
XII:651117..652439
Genome map
AA seq 440 aa AA seqDB search
MESQQLSQHPHISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPGTY
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccaacaattatctcaacacccacacatttctcatggtagcgcctgtgcttcg
gttacttctaaggaagtccacacaaatcaagatccgttagacgtttcagcttccaaaaca
gaagaatgtgagaaggcttccactaaggctaactctcaacagacaacaacacctgcttca
tcagctgttccagagaacccccatcatgcctctcctcaacctgcttcagtaccacctcca
cagaatgggccgtacccacagcagtgcatgatgacccaaaaccaagccaatccatctggt
tggtcattttacggacacccatctatgattccgtatacaccttatcaaatgtcgcctatg
tactttccacctgggccacaatcacagtttccgcagtatccatcatcagttggaacgcct
ctgagcactccatcacctgagtcaggtaatacatttactgattcatcctcagcggactct
gatatgacatccactaaaaaatatgtcagaccaccaccaatgttaacctcacctaatgac
tttccaaattgggttaaaacatacatcaaatttttacaaaactcgaatctcggtggtatt
attccgacagtaaacggaaaacccgtacgtcagatcactgatgatgaactcaccttcttg
tataacacttttcaaatatttgctccctctcaattcctacctacctgggtcaaagacatc
ctatccgttgattatacggatatcatgaaaattctttccaaaagtattgaaaaaatgcaa
tctgatacccaagaggcaaacgacattgtgaccctggcaaatttgcaatataatggcagt
acacctgcagatgcatttgaaacaaaagtcacaaacattatcgacagactgaacaataat
ggcattcatatcaataacaaggtcgcatgccaattaattatgagaggtctatctggcgaa
tataaatttttacgctacacacgtcatcgacatctaaatatgacagtcgctgaactgttc
ttagatatccatgctatttatgaagaacaacagggatcgagaaacagcaaacctaattac
aggagaaatctgagtgatgagaagaatgattctcgcagctatacgaatacaaccaaaccc
aaagttatagctcggaatcctcaaaaaacaaataattcgaaatcgaaaacagccagggct
cacaatgtatccacatctaataactctcccagcacggacaacgattccatcagtaaatca
actactgaaccgattcaattgaacaataagcacgaccttcaccttaggccaggaacttac
tga

DBGET integrated database retrieval system