KEGG   Saccharomyces cerevisiae (budding yeast): YLR259C
Entry
YLR259C           CDS       T00005                                 

Symbol
HSP60, CPN60, MIF4, MNA2
Name
(RefSeq) chaperone ATPase HSP60
  KO
K04077  chaperonin GroEL
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YLR259C (HSP60)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YLR259C (HSP60)
   03110 Chaperones and folding catalysts [BR:sce03110]
    YLR259C (HSP60)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YLR259C (HSP60)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YLR259C (HSP60)
Messenger RNA biogenesis [BR:sce03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     YLR259C (HSP60)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP60 / Chaperonin
   YLR259C (HSP60)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    YLR259C (HSP60)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YLR259C (HSP60)
  Exosomal proteins of other body fluids (saliva and urine)
   YLR259C (HSP60)
  Exosomal proteins of breast cancer cells
   YLR259C (HSP60)
  Exosomal proteins of colorectal cancer cells
   YLR259C (HSP60)
  Exosomal proteins of bladder cancer cells
   YLR259C (HSP60)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 850963
NCBI-ProteinID: NP_013360
SGD: S000004249
UniProt: P19882
Position
XII:complement(663284..665002)
AA seq 572 aa
MLRSSVVRSRATLRPLLRRAYSSHKELKFGVEGRASLLKGVETLAEAVAATLGPKGRNVL
IEQPFGPPKITKDGVTVAKSIVLKDKFENMGAKLLQEVASKTNEAAGDGTTSATVLGRAI
FTESVKNVAAGCNPMDLRRGSQVAVEKVIEFLSANKKEITTSEEIAQVATISANGDSHVG
KLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPL
LLLSEKKISSIQDILPALEISNQSRRPLLIIAEDVDGEALAACILNKLRGQVKVCAVKAP
GFGDNRKNTIGDIAVLTGGTVFTEELDLKPEQCTIENLGSCDSITVTKEDTVILNGSGPK
EAIQERIEQIKGSIDITTTNSYEKEKLQERLAKLSGGVAVIRVGGASEVEVGEKKDRYDD
ALNATRAAVEEGILPGGGTALVKASRVLDEVVVDNFDQKLGVDIIRKAITRPAKQIIENA
GEEGSVIIGKLIDEYGDDFAKGYDASKSEYTDMLATGIIDPFKVVRSGLVDASGVASLLA
TTEVAIVDAPEPPAAAGAGGMPGGMPGMPGMM
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgttgagatcatccgttgttcgtagtcgcgctactttaaggcctttattgcgtcgtgct
tactcctctcataaagaattgaaattcggtgtagaaggaagagcctcccttcttaagggt
gtcgaaactttagctgaagcggttgctgctactttgggtccaaagggtagaaacgtttta
atcgaacagcctttcggtcctccaaagattactaaggatggtgttacagttgccaaatct
attgtgttgaaggacaagtttgaaaatatgggtgccaagttactacaagaagttgcctcc
aaaaccaatgaggctgctggtgacggtactacttctgctactgtcttaggtagagccatc
ttcacagaatccgtcaaaaatgtcgccgctggttgtaaccctatggatttgagaaggggt
tctcaagttgcagttgaaaaagtgattgaatttttgagcgccaacaagaaagaaattacc
acatctgaggaaattgctcaagtagcaaccatttctgccaatggggactctcatgttggt
aagttactagcttcagctatggaaaaggttggaaaagaaggtgtcatcactatcagagaa
ggtagaacattggaagatgaacttgaggttactgaaggtatgaggtttgatcgtggtttt
atttctccatacttcatcactgatccaaagtcgagcaaggtggaatttgaaaagccattg
ctattgttgagtgaaaagaaaatttcttccattcaagatatcttgccagctttggaaatt
tccaatcaaagcagaagacctttgttgatcattgctgaagatgttgacggtgaagctctt
gcggcttgtattttgaacaagttgaggggtcaagttaaggtttgtgctgtgaaggcgcct
ggtttcggtgataatagaaagaatacaattggtgatattgcagtcttgacgggcggtact
gtttttactgaggagttggatttgaaaccagaacaatgtaccatagaaaacttgggttct
tgtgactctattaccgttactaaggaagacaccgttatcctgaacggtagtggtccaaag
gaagctattcaagagagaattgaacaaatcaaaggctccatcgacattaccaccacaaat
tcatatgagaaggagaaactgcaagagcgtttggccaaattgtccgggggtgttgctgtc
atcagggtcggtggtgcatctgaagttgaagttggtgaaaagaaggaccgttacgatgat
gctttgaacgctaccagagctgcagttgaggaaggtatcttgccaggtggtggtactgcc
ttagtgaaggcatctagagttttggatgaagttgttgtcgacaatttcgatcaaaaattg
ggtgtcgatatcataagaaaggccattacaagaccagccaagcagatcattgaaaacgct
ggtgaagaaggttcagttatcatcggcaaattgattgatgaatatggtgatgattttgcc
aagggttacgatgcctctaagtcagaatacaccgacatgttagccactggtatcatcgat
ccatttaaagtggttagatccggtttagttgatgcttctggtgttgcctcactattagct
actaccgaagttgctattgttgatgccccagaaccaccagcagctgctggcgctggtggt
atgccaggtggtatgccaggaatgccaggtatgatgtaa

DBGET integrated database retrieval system