KEGG   Saccharomyces cerevisiae (budding yeast): YLR268W
Entry
YLR268W           CDS       T00005                                 

Gene name
SEC22, SLY2, TS26, TSL26
Definition
(RefSeq) SNAP receptor SEC22
  KO
K08517  vesicle transport protein SEC22
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04130  SNARE interactions in vesicular transport
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    YLR268W (SEC22)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YLR268W (SEC22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLR268W (SEC22)
Membrane trafficking [BR:sce04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    YLR268W (SEC22)
SSDB
Motif
Pfam: Longin Synaptobrevin DUF1664 Phi-29_GP16_7 E1-E2_ATPase
Other DBs
NCBI-GeneID: 850973
NCBI-ProteinID: NP_013370
SGD: S000004258
UniProt: P22214
Position
XII:680200..680844
AA seq 214 aa
MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHY
LKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMT
KKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRK
SAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK
NT seq 645 nt   +upstreamnt  +downstreamnt
atgataaagtcaacactaatctacagagaagatgggctgcctctttgtacgtctgtggac
aacgaaaatgatccctcattatttgaacaaaagcaaaaggtgaaaatcgtcgtttccaga
ttgacaccacagtctgccacggaggctactttggaaagtggctcctttgagatccattat
ttgaagaaatccatggtgtactacttcgtcatttgcgaatctggatacccaagaaactta
gcattctcataccttaacgatatagcgcaagaatttgaacactcatttgctaatgagtac
cccaagcctaccgtaagaccataccagtttgtaaactttgataactttctacagatgaca
aaaaagtcatacagtgataagaaagttcaggacaatttggaccaactaaaccaagagctt
gtaggtgtcaagcaaatcatgtccaagaacatcgaagacctactttacaggggagattct
ctcgataaaatgagtgacatgagttcttctttgaaagaaacatccaaaaggtacagaaag
tccgcgcaaaagatcaacttcgatctcttgatcagtcaatatgctcctattgtcattgtc
gctttctttttcgtctttctcttctggtggatcttcctcaaatag

DBGET integrated database retrieval system