KEGG   Saccharomyces cerevisiae (budding yeast): YLR271W
Entry
YLR271W           CDS       T00005                                 

Gene name
CMG1
Definition
(RefSeq) Cmg1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: DUF4187 G-patch G-patch_2
Other DBs
NCBI-GeneID: 850976
NCBI-ProteinID: NP_013373
SGD: S000004261
UniProt: Q06152
Position
XII:682737..683561
AA seq 274 aa
MEESKTKRKEDRIDLKNTPPQKKSKRDSTNDETARTSLRSIMPRGYKMMENMGYKEGETL
GSNESALKEPIKVEINTKRRGIRAEKPDPSTMNDMQMSEQRFIKRESEMKNNKRLKKIWY
RIQKVAFEMMGDSDLYNPGEDPRDFNVLWRSYVMQLNEEVAKNDLNNHSNNDNEDKNNMI
PMVNESLEASPAIKGEKFGRPSTLIDCDTSIIGSRITKDTELAELEELSIEKRITKLNIF
LRSEKYYCFFCGIKYKDEGDLYEHCPGVNEDDHK
NT seq 825 nt   +upstreamnt  +downstreamnt
atggaggagagtaagacaaaaagaaaagaggatcgcatagatttgaagaatacaccgcct
cagaagaagtcaaaaagagattcaacaaatgacgaaactgcacgcacatcactacgttca
atcatgcccaggggttataaaatgatggaaaacatgggttacaaagaaggagaaacatta
ggtagtaatgaaagtgccctaaaagagcctattaaggtagaaatcaatacaaaaaggagg
ggaattcgtgcagaaaagcccgacccatcaacaatgaatgacatgcagatgagtgaacaa
cgatttataaaaagagaaagtgaaatgaaaaataataagcggttaaaaaaaatttggtat
aggatccaaaaagttgcttttgaaatgatgggtgattccgatttatacaatccaggcgaa
gatccgagagactttaacgtactttggagatcttacgttatgcaactaaatgaggaagta
gcaaaaaatgacctaaataatcacagtaacaatgataatgaagataagaataatatgata
ccaatggtaaatgaaagtttggaggcttcgcctgcaataaaaggtgaaaagtttggacgt
ccttctacattaatagattgtgatacttcaattatcggtagtcgcattacaaaagacaca
gaacttgctgaattagaagaattgagcattgaaaaaagaataacaaaattgaatatattc
ctgaggtccgagaagtactactgttttttttgcggaatcaagtataaggatgaaggtgat
ctctacgagcattgcccaggagtgaatgaagacgaccacaaatga

DBGET integrated database retrieval system