KEGG   Saccharomyces cerevisiae (budding yeast): YLR286C
Entry
YLR286C           CDS       T00005                                 

Gene name
CTS1, SCW2
Definition
(RefSeq) chitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YLR286C (CTS1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     YLR286C (CTS1)
SSDB
Motif
Pfam: Glyco_hydro_18 CBM_19
Other DBs
NCBI-GeneID: 850992
NCBI-ProteinID: NP_013388
SGD: S000004276
UniProt: P29029
Structure
PDB: 
2UY2 2UY4 4TXE 2UY3 2UY5

Position
XII:complement(708448..710136)
AA seq 562 aa
MSLLYIILLFTQFLLLPTDAFDRSANTNIAVYWGQNSAGTQESLATYCESSDADIFLLSF
LNQFPTLGLNFANACSDTFSDGLLHCTQIAEDIETCQSLGKKVLLSLGGASGSYLFSDDS
QAETFAQTLWDTFGEGTGASERPFDSAVVDGFDFDIENNNEVGYSALATKLRTLFAEGTK
QYYLSAAPQCPYPDASVGDLLENADIDFAFIQFYNNYCSVSGQFNWDTWLTYAQTVSPNK
NIKLFLGLPGSASAAGSGYISDTSLLESTIADIASSSSFGGIALWDASQAFSNELNGEPY
VEILKNLLTSASQTATTTVATSKTSAASTSSASTSSASTSQKKTTQSTTSTQSKSKVTLS
PTASSAIKTSITQTTKTLTSSTKTKSSLGTTTTESTLNSVAITSMKTTLSSQITSAALVT
PQTTTTSIVSSAPIQTAITSTLSPATKSSSVVSLQTATTSTLSPTTTSTSSGSTSSGSTS
SDSTARTLAKELNAQYAAGKLNGKSTCTEGEIACSADGKFAVCDHSAWVYMECASGTTCY
AYDSGDSVYTQCNFSYLESNYF
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtcactcctttacatcattcttctattcacacaattcttactactgccaaccgatgcc
tttgataggtctgctaacacaaatattgctgtttattggggtcaaaactcagcaggaacg
caagaatccttagctacttactgtgaatcttctgatgctgatattttcctattatctttc
ttgaaccaatttccaacccttggtttgaactttgccaacgcatgctctgatactttttct
gatggcttacttcactgcacccagattgctgaagatattgaaacttgccagtccctagga
aagaaagttctattatcattaggtggtgcatctggtagctacctcttttcagatgattct
caagcggaaacttttgcacaaactttatgggatactttcggtgaaggtacaggtgccagt
gagagaccatttgactcagcagtcgttgatggttttgattttgatattgaaaacaacaac
gaagtaggctatagtgcgttagctaccaagttaagaactttgtttgccgaaggtacaaag
caatattacctttctgccgcaccacaatgtccatacccggatgcttctgttggtgacttg
ttggaaaatgcagacattgattttgcgttcatccaattttacaataattactgcagtgtg
agtggtcaattcaattgggatacttggttaacctatgctcaaactgtatccccaaataaa
aatatcaaactgttcttaggtttacctggttctgcttctgctgctggctctggttatatt
tctgacacttctttattggaatcaactattgcagatattgcctcttcaagttcttttggt
ggtattgcgttatgggatgcatctcaagccttttccaacgagctaaatggtgaaccatat
gttgagattttgaagaatttgctaacaagtgctagccagaccgccactactacagttgcc
acctcaaaaacctcagcagcctcaacttcatctgcttcaacttcatctgcttcaacttct
cagaaaaagaccacacaatctacgacatctacacaaagtaaaagcaaagttactttatct
ccaactgcaagcagcgctatcaaaacatcaattactcaaactacaaaaacattgacgagt
agcaccaagacaaaatctagtctaggtaccaccacaacagagagcactttaaattcagtt
gctatcacaagtatgaaaactactctatcttcccaaataaccagtgctgccttggtgacc
cctcaaacaactactactagcatagtttcttcggccccaattcaaacagctatcactagt
actctttcgccagcaacgaagagttcttctgtcgtttccctacagacagctactactagt
acgctttccccaacaacgaccagtacaagctcaggtagtacaagctcaggtagtacaagc
tcagacagtacagctcgtacattggctaaagaattgaatgctcaatatgcggctggtaaa
ttgaacggtaaatctacctgtactgaaggtgaaattgcatgctctgctgatgggaagttc
gccgtttgtgatcatagcgcttgggtttacatggaatgtgcttctggaaccacatgttat
gcttatgactccggcgactcagtctatacccaatgtaatttctcttatttggaaagcaat
tacttttaa

DBGET integrated database retrieval system